Entry information : CsPrx19 (orange1.1g048664m/Cs2g21820)
Entry ID 1371
Creation 2007-02-14 (Christophe Dunand)
Last sequence changes 2011-07-02 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2017-12-14 (Qiang Li)
Peroxidase information: CsPrx19 (orange1.1g048664m/Cs2g21820)
Name (synonym) CsPrx19 (orange1.1g048664m/Cs2g21820)
Class Class III peroxidase    [Orthogroup: Prx009]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation N/D
Tissue types Ovaries
Seedlings
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsPrx19
start..stop
S start..stop
CclPrx40 669 0 1..325 1..325
CppPrx13 655 0 4..325 1..322
MePrx24 498 2e-179 1..325 1..325
RcPrx71 495 2e-178 7..325 4..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 164758..164967 210 N° 2 165067..165258 192 N° 3 165359..165521 163 N° 4 165639..166051 413
join(164758..164967,165067..165258,165359..165521,165639..166051)


exon

Literature and cross-references CsPrx19 (orange1.1g048664m/Cs2g21820)
Literature Forment,J., et al., Development of a citrus genome-wide EST collection and cDNA microarray as resources for genomic studies. Plant Mol. Biol. 57 (3), 375-391 (2005).
DNA ref. Citrus sinensis Annotation Project:   chr2 (18911509..18913930) Phytozome 12:   scaffold00064 (164758..166051)
EST ref. GenBank:   CK936139 [5' end]   CX303177 [3' end]
Cluster/Prediction ref. UniGene:   Csi.4823
Protein sequence: CsPrx19 (orange1.1g048664m/Cs2g21820)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (302)
PWM (Da):   %s   35627.3 (33090.0) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.9 (9.10) Peptide Signal:   %s   cut: 24 range:24-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGRIDYIGVVFLSLFGVVGLSEAQLQLGFYAKSCPRAEKIVLDYVNKHIHNAPSLAASFLRMHFHDCFVRGCDASVLLNSTGNPERNAVPNQTLTGATFDFIERVKRLVEDACPGIVSCADILTLVTRDSIVATGGPSWKVPTGRRDGRVSIRAEAQNNIPAPTNNFTLLQRSFANQGLDLKDLVLLSGAHTIGVSHCTSVSSRLYNFTGVGDQDPALDSEYAANLKARKCRTPNDNTTLLEMDPGSRKTFDLSYYNLLLKRRGLFVSDASLTTNSFTLSLVKQLLQGSLENFFAEFAKSVEKMGRNKVKTGSEGEIRKRCAFVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 6 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAAGGATAGACTACATTGGTGTCGTATTTTTAAGTCTTTTTGGTGTTGTAGGCCTGAGTGAAGCTCAATTGCAACTGGGATTTTATGCTAAGAGCTGCCCAAGAGCTGAAAAGATT
GTGTTAGACTATGTTAACAAACACATCCACAATGCCCCCTCATTAGCCGCATCTTTCCTCAGAATGCATTTCCATGATTGCTTTGTCAGG
GTTAGCACAATATTTCACCTTTTGGAAGCT
TTGCATAAAACTCTTATCTCCGTTTTACATTTTGTTTCTTGCTGACGCGCGCTTCGCTTTGCATCTCAGGGCTGTGATGCATCCGTGCTGCTAAACTCAACAGGCAATCCTGAAAGAAAT
GCCGTTCCAAATCAAACATTGACAGGCGCAACCTTTGATTTCATCGAAAGAGTGAAGAGACTAGTCGAAGATGCATGCCCCGGCATAGTTTCTTGTGCAGATATTCTTACGTTAGTTACA
AGAGACTCTATTGTAGCCACA
GTAAGCGTTGCATTTTCATTTTCTTCTTGAGACAAGATAATTAATTAACAAGACTACAGAGCTTCTGTTTCTGTCTAATTTTACTTGCTGTTGACTTCA
GGGAGGTCCTTCCTGGAAAGTTCCAACCGGACGAAGAGACGGGCGAGTCTCCATTCGTGCAGAAGCCCAAAACAATATCCCAGCTCCTACTAACAACTTCACCCTTCTTCAACGAAGTTT
TGCTAATCAAGGACTTGATTTGAAGGACCTGGTTCTGCTCTCAG
GTAAGCACAACAACTAAAGTGTTTGGTAATTTTTATTTTATTTTTAATCTTTTAAGTCGTGGCACCGTAATTCTAG
ATGGAATTAAGCTTGACAAAAAGGCTTTCATGTTGTTTCAGGTGCACACACAATCGGGGTCTCCCACTGCACTTCAGTTTCAAGCCGGCTGTACAATTTCACAGGAGTGGGTGACCAAGA
CCCTGCTCTTGACAGTGAATATGCAGCAAATCTCAAGGCAAGAAAGTGCAGAACTCCAAATGATAACACTACATTACTTGAAATGGACCCTGGTAGCCGCAAGACATTTGATCTTAGCTA
CTACAATCTTTTGCTTAAGAGAAGGGGTCTCTTTGTATCTGATGCTTCTTTGACTACAAACTCTTTCACTTTGTCTTTGGTTAAGCAACTTCTTCAGGGATCATTGGAAAATTTCTTTGC
TGAATTTGCCAAGTCTGTGGAGAAAATGGGAAGGAATAAGGTTAAGACTGGATCAGAAGGTGAGATCAGGAAGCGCTGCGCTTTTGTCAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAAGGATAGACTACATTGGTGTCGTATTTTTAAGTCTTTTTGGTGTTGTAGGCCTGAGTGAAGCTCAATTGCAACTGGGATTTTATGCTAAGAGCTGCCCAAGAGCTGAAAAGATT
GTGTTAGACTATGTTAACAAACACATCCACAATGCCCCCTCATTAGCCGCATCTTTCCTCAGAATGCATTTCCATGATTGCTTTGTCAGG
GGCTGTGATGCATCCGTGCTGCTAAACTCA
ACAGGCAATCCTGAAAGAAATGCCGTTCCAAATCAAACATTGACAGGCGCAACCTTTGATTTCATCGAAAGAGTGAAGAGACTAGTCGAAGATGCATGCCCCGGCATAGTTTCTTGTGCA
GATATTCTTACGTTAGTTACAAGAGACTCTATTGTAGCCACA
GGAGGTCCTTCCTGGAAAGTTCCAACCGGACGAAGAGACGGGCGAGTCTCCATTCGTGCAGAAGCCCAAAACAATATC
CCAGCTCCTACTAACAACTTCACCCTTCTTCAACGAAGTTTTGCTAATCAAGGACTTGATTTGAAGGACCTGGTTCTGCTCTCAG
GTGCACACACAATCGGGGTCTCCCACTGCACTTCA
GTTTCAAGCCGGCTGTACAATTTCACAGGAGTGGGTGACCAAGACCCTGCTCTTGACAGTGAATATGCAGCAAATCTCAAGGCAAGAAAGTGCAGAACTCCAAATGATAACACTACATTA
CTTGAAATGGACCCTGGTAGCCGCAAGACATTTGATCTTAGCTACTACAATCTTTTGCTTAAGAGAAGGGGTCTCTTTGTATCTGATGCTTCTTTGACTACAAACTCTTTCACTTTGTCT
TTGGTTAAGCAACTTCTTCAGGGATCATTGGAAAATTTCTTTGCTGAATTTGCCAAGTCTGTGGAGAAAATGGGAAGGAATAAGGTTAAGACTGGATCAGAAGGTGAGATCAGGAAGCGC
TGCGCTTTTGTCAATTAG

Retrieve as FASTA