Entry information : HaPNC01 (HanXRQChr02g0058801)
Entry ID 13712
Creation 2016-05-13 (Christophe Dunand)
Last sequence changes 2016-05-13 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPNC01 (HanXRQChr02g0058801)
Name (synonym) HaPNC01 (HanXRQChr02g0058801)
Class Plantacyanin    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPNC01
start..stop
S start..stop
HaPNC16 219 6e-76 1..126 1..126
HaPNC11 211 1e-72 1..125 1..125
HaPNC22 209 4e-72 1..125 1..125
HaPNC20 209 4e-72 1..125 1..125
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 177428634..177428811 178 N° 2 177427084..177427283 200  
complement(join(177427084..177427283,177428634..177428811))


exon

Literature and cross-references HaPNC01 (HanXRQChr02g0058801)
DNA ref. HanXRQ genome:   HanXRQChr02 (177428811..177427084)
Protein sequence: HaPNC01 (HanXRQChr02g0058801)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   126 (97)
PWM (Da):   %s   13142.79 (10292.3)  
PI (pH):   %s   10.33 (10.74) Peptide Signal:   %s   cut: 30 range:30-126
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAQGRGSAVVATAVLCLLAVSLHCEVAEAATYVVGGRGGWSFNVSGWSRGKKFKAGDVLVFSYQKGAHNVVAVNKAGYDKCSTTPRNTKVYTSGKDRIRLVKGLNNFICTLPGHCGAGMKIQISA

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCACAGGGAAGAGGCAGTGCGGTGGTAGCTACGGCGGTGCTCTGCCTGCTTGCGGTGTCGCTTCACTGCGAGGTAGCTGAAGCCGCTACTTACGTGGTTGGCGGCCGCGGTGGCTGG
TCCTTCAACGTCTCTGGCTGGTCAAGAGGCAAAAAGTTCAAGGCTGGCGACGTCCTTG
GTATGCTAACAACATCATTTTATTCACTACTTTACGTCTTTTATTTATGTTTCATCGTTGGG
TAATTTCGATATTGTAGTAAGGTTTTAAGTGTATTTTAGGGAAGTAGATTTTTCTTACTTTTTAAGGGACTTTTCCAGTGATTGCCTTGTTTGTGTTTATACCCAAATGATGTTGTATGC
ATGCTATTATATATGATTTACATTATATTGTGTCACTATGATCACTTTCTTGGTGGGTGTGGGTGACTTCTTATTTCTATATTCTTTGACTTGGTGTGTTGGTATGCTGGTCGTTTTCGA
GCCGAGTGTCTTTCTGGAAGCAGTCTCTCTATCCCTATGAGTAGCTTTGCTATTTATGGGATTTATTGGATATGGTTGTTGTTTTATCGTTGGGTAATCTACTGGAAACATGGTGTGGGT
AAAGAATTACTTACAAATAGGATCACCTATTTATTTATATAAAGTTTTTGAATTTTCTGCTTTATGTGGATACAATATACTTTTTCGGAGTTAATTGCATAGTTTGTTTGCACAAAATAA
CATACTTAGGTACTAATAGTTTAAAATCACTTTCTAGGGTATTAACTTTTCATTTTGTAACATTTGGAGGTATTAACTTCTAGGGTATTAACATAGTTAGTCTCTGTGGTTTGCACAAAA
TAGCATACTTAGGTGCTAATAGAATGTGATTTTAAACCTACAAATAATGTTAATACCTTCTAGGGGTGCAAACGAGCCGAGCGGCTCGCGAGCTACTCGAGATCGGCTCGAGAAAAAGCT
CGAAATGAGTCGAGCCTTATCGAGCCCGAGCCGAGCTTGAGCCTAAAATAAAGCTCGTCTGTTATCGAGCCCGAGCTCGAGCCTCGCATGTGAAGCTCGTTAGGCTCGTCGAGCCTTAGT
GTAAACGAGCCGATTCGAGTCGAGCTTATTCAAACTTGTTTACAAGCCGACCTCAAACCTAAAAATAAGCTTATTTAGTAAACGAGCCCGAGCTTCACTTATCGAGCTCACGAGCCTAAA
AAGTCTATTATTTATATTATTTTTATTTAATATATTAATTAATAGATAGTAAACAAGTCGAGCCCGAGCCGAGCTCGAGCCCGAGCTCACATAAAGTTAATCGAGCTCGAGCCTGGTCAA
GCTCGGGCTCGGCTCGGCTCGTTTGCACCCCTAATACCTTCAAACGTTACAAAATGAAAAGTTAATACCCTAGAATGTGATTTTAAACTATTAGTACCTAAGTATGTTATTTTGTGCAAA
TTACAGGGACTAACTAAGTAATTAATTCTACTTTGTCATTCATTTTTCTAGTAGTGTGATACTAATTTTTTTTTAATCATGTGTTTAGTTTTCAGCTACCAAAAAGGAGCACATAACGTG
GTGGCAGTTAATAAGGCGGGGTATGATAAGTGTAGCACCACTCCAAGAAATACAAAGGTGTACACAAGTGGAAAAGACCGAATTAGGCTTGTCAAGGGTCTCAACAACTTCATTTGTACT
CTTCCTGGTCACTGTGGTGCTGGCATGAAGATTCAAATCTCTGCTTCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCACAGGGAAGAGGCAGTGCGGTGGTAGCTACGGCGGTGCTCTGCCTGCTTGCGGTGTCGCTTCACTGCGAGGTAGCTGAAGCCGCTACTTACGTGGTTGGCGGCCGCGGTGGCTGG
TCCTTCAACGTCTCTGGCTGGTCAAGAGGCAAAAAGTTCAAGGCTGGCGACGTCCTTG
TTTTCAGCTACCAAAAAGGAGCACATAACGTGGTGGCAGTTAATAAGGCGGGGTATGATAAG
TGTAGCACCACTCCAAGAAATACAAAGGTGTACACAAGTGGAAAAGACCGAATTAGGCTTGTCAAGGGTCTCAACAACTTCATTTGTACTCTTCCTGGTCACTGTGGTGCTGGCATGAAG
ATTCAAATCTCTGCTTCT

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCCATTCCAA CCTCCCACAA ACAAAACACG TGAAACTGAC ACCAACCCAC TTCTTTGACT GAATTATGGC ACAGGGAAGA GGCAGTGCGG TGGTAGCTAC GGCGGTGCTC TGCCTGCTTG  CGGTGTCGCT TCACTGCGAG GTAGCTGAAG CCGCTACTTA CGTGGTTGGC GGCCGCGGTG GCTGGTCCTT CAACGTCTCT GGCTGGTCAA GAGGCAAAAA GTTCAAGGCT GGCGACGTCC  TTGTTTTCAG CTACCAAAAA GGAGCACATA ACGTGGTGGC AGTTAATAAG GCGGGGTATG ATAAGTGTAG CACCACTCCA AGAAATACAA AGGTGTACAC AAGTGGAAAA GACCGAATTA  GGCTTGTCAA GGGTCTCAAC AACTTCATTT GTACTCTTCC TGGTCACTGT GGTGCTGGCA TGAAGATTCA AATCTCTGCT TCTTAAACAT TTACAAATAA TTATAAAAAT AAAATTAAAT  AAACCGCGAA TTCTAGAATA TTATGTATGT GTTACGAGTC TTGTGGTTTC ATTAATAAAA ATCCACTCGG AAGTTATATT GTATGGTGTG TGACGTATAT GTGTTAGAAG ATCAAATACA  AATAGTCTTA TCTTACAAAA TTATCTTACA AAATGTACAA AAGGCATGGA AAAGAAAAAA AAACACGGTG ATATTTTTAT AATTATTTAC TCGTAGAGTA CCCTACATAT GATCTTGCAT 
GGTATTATAT AATTACTTTA CAAATGAT 

Retrieve as FASTA