Entry information : HaCRX05 (HanXRQChr05g0145381)
Entry ID 13716
Creation 2016-05-13 (Christophe Dunand)
Last sequence changes 2016-05-13 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaCRX05 (HanXRQChr05g0145381)
Name (synonym) HaCRX05 (HanXRQChr05g0145381)
Class Other cupredoxin Protein    [Orthogroup: CRX002]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaCRX05
start..stop
S start..stop
HaCRX04 123 6e-38 18..113 45..138
HaCRX02 123 6e-38 18..113 45..138
HaCRX03 77 1e-19 20..105 54..138
HaSTC30 64 0.000000000000008 18..51 67..100
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 130059683..130059770 88 N° 2 130059860..130060110 251  
join(130059683..130059770,130059860..130060110)


exon

Literature and cross-references HaCRX05 (HanXRQChr05g0145381)
DNA ref. HanXRQ genome:   HanXRQChr05 (130059683..130060110)
Protein sequence: HaCRX05 (HanXRQChr05g0145381)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   113
PWM (Da):   %s   12222.36  
PI (pH):   %s   8.37
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLVTVKVGTRVLISKLGADGKQFFKRDSIVFNYEYGKHNVALLPDKASLDNCILDKPILTLADCGRNCLFLCNTGPCSVASTKGDDCKKGLKFSFETKPLPAVLELEGAQYL

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGGTGACTGTAAAGGTTGGAACGAGGGTGTTGATCTCCAAGCTTGGGGCCGACGGGAAGCAATTCTTTAAGAGAGACAGTATTGGTACATTCTTATACATAATTAATCATACATGA
TTTGATTTGTTATAAGTGTTCGTCTAACTAATTAAATTATCTATATTGCTGATGCAGTTTTCAATTACGAATACGGAAAACACAATGTAGCGCTACTACCAGATAAAGCCTCGTTGGATA
ACTGTATTCTTGATAAGCCAATTCTAACACTCGCTGATTGTGGAAGGAATTGTCTCTTCCTATGTAACACAGGACCGTGTTCTGTAGCCAGCACCAAAGGAGATGATTGTAAGAAAGGCC
TAAAGTTTTCGTTCGAAACAAAGCCATTACCTGCAGTACTGGAACTGGAAGGAGCACAATACTTAACT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGGTGACTGTAAAGGTTGGAACGAGGGTGTTGATCTCCAAGCTTGGGGCCGACGGGAAGCAATTCTTTAAGAGAGACAGTATTGTTTTCAATTACGAATACGGAAAACACAATGTA
GCGCTACTACCAGATAAAGCCTCGTTGGATAACTGTATTCTTGATAAGCCAATTCTAACACTCGCTGATTGTGGAAGGAATTGTCTCTTCCTATGTAACACAGGACCGTGTTCTGTAGCC
AGCACCAAAGGAGATGATTGTAAGAAAGGCCTAAAGTTTTCGTTCGAAACAAAGCCATTACCTGCAGTACTGGAACTGGAAGGAGCACAATACTTAACT

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAGAAATTAA AATGGCTAAC AAAAATTTGT GTCTTTTCAT CCTCATAGCA ACAATAGTGA CTCAAGCTAC TTGGGTTCAA GCTGTGGAAT ATAATGCTGG TGACTGTAAA GGTTGGAACG  AGGGTGTTGA TCTCCAAGCT TGGGGCCGAC GGGAAGCAAT TCTTTAAGAG AGACAGTATT GTTTTCAATT ACGAATACGG AAAACACAAT GTAGCGCTAC TACCAGATAA AGCCTCGTTG  GATAACTGTA TTCTTGATAA GCCAATTCTA ACACTCGCTG ATTGTGGAAG GAATTGTCTC TTCCTATGTA ACACAGGACC GTGTTCTGTA GCCAGCACCA AAGGAGATGA TTGTAAGAAA  GGCCTAAAGT TTTCGTTCGA AACAAAGCCA TTACCTGCAG TACTGGAACT GGAAGGAGCA CAATACTTAA CTTAAAATTG AGGATTACAT GTCTTGGCTT TTATACATTT TTTTTGTGTG 
TTTGTTAATA ATTGTTCATA TCTATTGTAG GAACTAGGTT CACGTTTTAT TAAAAATATT AATAAAATAA ATATAATAAC GAGACTCTCG TTATTTGTGG 

Retrieve as FASTA