Entry information : HaUCC09 (HanXRQChr17g0552421)
Entry ID 13717
Creation 2016-05-13 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaUCC09 (HanXRQChr17g0552421)
Name (synonym) HaUCC09 (HanXRQChr17g0552421)
Class Uclacyanin    [Orthogroup: UCC004]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaUCC09
start..stop
S start..stop
HaUCC07 155 9e-48 46..234 1..195
AtUCC01 114 4e-31 52..198 6..153
AtUCC05 110 2e-30 46..235 1..182
HaUCC04 110 2e-30 52..211 1..163
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 77430656..77430722 67 N° 2 77432694..77432936 243 N° 3 77433561..77433955 395  
join(77430656..77430722,77432694..77432936,77433561..77433955)


exon

Literature and cross-references HaUCC09 (HanXRQChr17g0552421)
DNA ref. HanXRQ genome:   HanXRQChr17 (77430656..77433955)
Protein sequence: HaUCC09 (HanXRQChr17g0552421)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   235
PWM (Da):   %s   24701.33 Transmb domain:   %s   i49-71o
PI (pH):   %s   7
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MICEASAIIVRQLTLCHICRHVTMTNIIQTHTFLKITLFFQEYKIMAKVSIMRVLIGLAAMVMLLQVVVATDYTVGSPSGGWDTTTDLGSWSSSQTFTVGDNLDFQFGPTHDVVEVTKDNYDSCGTGNAISTTTTSPARIALTSAGTRYFICGRSNHCSLGMKVQVNVVAASTPTTPSPPQTTTPSSPTPPEAGPTSPSPPPPATGTNVEPPSSAISLKMTAGTMLGLGFLVML

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATTTGTGAGGCTTCGGCAATCATCGTACGGCAGCTCACACTTTGTCACATATGTAGACATGTAAGTTGATCCCCATCTTTTATACTAGCTTATTTAGGGCTGTTTGTTTACCTCTTA
ATAACTCTTAATAAGACCCTTAATAGTTCAGACATTTCAGACTATTTGTTTCACGAGCAGATGTCTGAATGGTTCAGACATTTGCCTCTGAATGGTTAAGATTTACACAGAGTCTGAATG
GTTAAGACCTCTAATCTGAATTGGTCAAACATTTGCCCCTGAACGGTTAAACCATTATACAAGCTCTTAACGGTAAAGGTGGTGGTTAGGGCCTAGGGGTGTTCCATATTTGGTTTCAAA
CCAAATAACTGAAAACCAAACTAAACTAAAAACATTTAAAATCGAACCGAATTGCATATTTGGTTTTCGGTTTGGTTTAAAACCGAAATGAGTTTTGGTAACTTGTTTACGGTTCTAGAT
TCAGTTCGGTTAAACTTAAAACCGAGGAACCCAATACATATATTGTGCTAGGGATTTTAGCCTATTACAAAACTAAGAAAACCGAAGGAATACCTATCTTGTTAAAATTTAGGATTTCCG
ATAAGAAACCACAACCAAACAAAATTAGAATTCAGATTTCGGTTCGGTTTTGCCAACTTTGAATTTAGTTTGGTTTTGTTATGAGTTTCGACTAGGGATGAGCATTTGGTACTGGGTACC
GGTACTGAATTTCCCGTACCGAATTTTTTCGGTACCGGTACCGGTACCCACTTTTTGCCATTTTTGGTATCGGTACTTTCGGTATCGGTATCGGTACCGGTTCGGTACGGTACCGGGAAA
ATACGGAATTTTACCTTCAAATAACGTTACCGTACCCAGTTTTGGTGAATTTCGGTATCGGTATTTCGATACCGGTACCGGTTCGGTACGGTACCGGTACCACACTCATCCCTAATTTCG
ACCGAAATACATATAATAAACGAGGAAACCAAAACTCGAACCGATAAACACCTTACTGATGGTGCAATCCTAATAGTGGTGATGGCATTGACATAGTGATAGATTAGGAGATTCTAACTT
AATTGGTTGATTTTGGTCCAATTTTCAAGAAAATTATAAATTGTTTACTTCAATAAATATGAGGAACTCATAACATAAATACATAAATATGTTTAGATAATTGAATTCTAATGAATCAAA
CGCTATCTTTTTTAAGAGATTATAATATGTAGGGGCGTAGCTACATAGAAGGGTATGGGTTCGTCCGAACTCGTATAAATTTTTTTTAGCTTAATTGAATTCTAATGAACCAAACGCTAC
CAGAGATTATAATATGATAACTATGTATGATGAATATGTGACTAGTGTAATAATGAAAGATCAATCCGACCCGTTCTGTTTAACAATGAAAGATCAGCCCTCTTTTAAGATCAACCCGAC
CCATAATTTTTTTTGGCACAAACTTACTCCAAGATCAATCCGACCCGATTGATTCGTTCCAAAAAAGTTATTCCAAACAGAACATATAACTGTTTTAAATAATCTAAATCTGACTTTTAA
CCGTCACGAATCATCATCTAAATAGATAAAAACTCTCATGCCGAACTCAAGTTTGGCTTGAACATTGACCGGCTCTCCATTGCATGTTTTTTCAATCGGTCAAGCCGGCATTATAAACAA
GAATACAAGATCATCATCATCATGTCTTTAAACCTTAAACAACAACTAAAACATTATCATCTTCACCTGCTCTCTAGTTATTTAAAACATGCCTACACTAATTGACAAGAAATATTCAAC
AAAACATGTTCCCACAAGCCAAGTCAACTAACATTTCATAAATAACATTAAAAAGTCAACTAATCCATCACTCATCTACCAAATCAACAACACCATGACAGCCATCCAATTCAAACATGC
AACTAATCCAATTTGAATAATGCAACAATGAAAGCTTCAAAGAAATTTGAAACAATAAACAATTCGGGCCGAATGAGTTCTTCCCCTTTGTATAATTCTATAAATAGATGGTTTATAGCC
ATGACAAACATCATACAAACACACACTTTCTTGAAAATCACCTTGTTTTTTCAAGAATATAAAATAATGGCTAAAGTGTCAATTATGAGGGTACTAATCGGGTTGGCTGCTATGGTGATG
CTTCTACAGGTGGTGGTGGCGACTGACTACACTGTTGGAAGTCCAAGCGGCGGGTGGGACACGACAACTGATCTGGGGTCGTGGTCTTCATCCCAAACATTTACAGTTGGCGATAATCTA
G
GTAACGAATTTATATATGTTTCTTGCCTAGAGCACGCGTTACCAATCTAGGGGTGCCAGTTTATTACATGAACCTAACATGAATTTAATAGGTTTGGAAATCGACCAAAAGCTGCGAAC
GCATATAGCTAAACGGGTTGGGCTTGCGTTGGCTTGAGGGATTCTAGGGTGACCCGCGTAGCCCATTTGTTTTAAAAAAAAGTTATATGTAATTTTATGTCATAACTAAAAATGGACTGG
TATTTTATGTCAAAACTTAAAATTTAAAAGAGCTTTCGACATCTAACTTTTATAATTTAAACGTAATTGTTTTATATGCATTTGTAATTTTTATTGTATTTTATAATTTAGAGTATTAAT
ATGGGAACACAAATTTAAAAAAAAATTGAGTCACGCGGGTCGTGTTTGTGTCAACCCGCCAATATTCTTGATGTGTTCAGTTTCACGTGTCTGACATGATTTCAAGTCTCGTCGACACGA
CTCATTTAGCACCCTTAATCACCGTAACATACTTTTTTCAGGGAAATAAAATTATATAACTTTTTTTTATTTTTTTATTCAACCTACGAAGCGTTAGGTAGCCGCTACGGGCTGCCCCTC
TAACAATGATCTTAACTGGTTGCAGATTTCCAGTTTGGTCCTACCCATGATGTTGTTGAGGTCACAAAGGACAACTATGATTCATGTGGAACAGGAAATGCTATTTCAACCACCACGACT
AGCCCGGCTAGAATCGCACTAACCTCAGCAGGAACCCGGTATTTCATCTGTGGTAGAAGCAATCATTGCAGCCTAGGAATGAAGGTTCAGGTAAATGTAGTAGCAGCCTCAACACCAACA
ACACCTTCACCGCCACAAACCACCACCCCATCATCCCCAACTCCGCCAGAAGCTGGTCCTACAAGTCCTTCACCGCCACCACCTGCCACCGGAACGAATGTGGAGCCTCCATCATCAGCT
ATATCACTAAAGATGACCGCTGGAACTATGCTTGGGCTTGGGTTCCTTGTCATGCTGCTA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATTTGTGAGGCTTCGGCAATCATCGTACGGCAGCTCACACTTTGTCACATATGTAGACATGTAACCATGACAAACATCATACAAACACACACTTTCTTGAAAATCACCTTGTTTTTT
CAAGAATATAAAATAATGGCTAAAGTGTCAATTATGAGGGTACTAATCGGGTTGGCTGCTATGGTGATGCTTCTACAGGTGGTGGTGGCGACTGACTACACTGTTGGAAGTCCAAGCGGC
GGGTGGGACACGACAACTGATCTGGGGTCGTGGTCTTCATCCCAAACATTTACAGTTGGCGATAATCTAG
ATTTCCAGTTTGGTCCTACCCATGATGTTGTTGAGGTCACAAAGGACAAC
TATGATTCATGTGGAACAGGAAATGCTATTTCAACCACCACGACTAGCCCGGCTAGAATCGCACTAACCTCAGCAGGAACCCGGTATTTCATCTGTGGTAGAAGCAATCATTGCAGCCTA
GGAATGAAGGTTCAGGTAAATGTAGTAGCAGCCTCAACACCAACAACACCTTCACCGCCACAAACCACCACCCCATCATCCCCAACTCCGCCAGAAGCTGGTCCTACAAGTCCTTCACCG
CCACCACCTGCCACCGGAACGAATGTGGAGCCTCCATCATCAGCTATATCACTAAAGATGACCGCTGGAACTATGCTTGGGCTTGGGTTCCTTGTCATGCTGCTA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATTTGTG AGGCTTCGGC AATCATCGTA CGGCAGCTCA CACTTTGTCA CATATGTAGA CATGTAACCA TGACAAACAT CATACAAACA CACACTTTCT TGAAAATCAC CTTGTTTTTT  CAAGAATATA AAATAATGGC TAAAGTGTCA ATTATGAGGG TACTAATCGG GTTGGCTGCT ATGGTGATGC TTCTACAGGT GGTGGTGGCG ACTGACTACA CTGTTGGAAG TCCAAGCGGC  GGGTGGGACA CGACAACTGA TCTGGGGTCG TGGTCTTCAT CCCAAACATT TACAGTTGGC GATAATCTAG ATTTCCAGTT TGGTCCTACC CATGATGTTG TTGAGGTCAC AAAGGACAAC  TATGATTCAT GTGGAACAGG AAATGCTATT TCAACCACCA CGACTAGCCC GGCTAGAATC GCACTAACCT CAGCAGGAAC CCGGTATTTC ATCTGTGGTA GAAGCAATCA TTGCAGCCTA  GGAATGAAGG TTCAGGTAAA TGTAGTAGCA GCCTCAACAC CAACAACACC TTCACCGCCA CAAACCACCA CCCCATCATC CCCAACTCCG CCAGAAGCTG GTCCTACAAG TCCTTCACCG  CCACCACCTG CCACCGGAAC GAATGTGGAG CCTCCATCAT CAGCTATATC ACTAAAGATG ACCGCTGGAA CTATGCTTGG GCTTGGGTTC CTTGTCATGC TGCTATAAGA ATTCATTGAC  AATGTGTTTT GCCACTTTTT ACTTGTTTTC ATTATATAAA TTTCATCATT TTGTTATATA ATCATGTACT TGTGTTTGTT AAAATTCATT GAATAACAGA TTGTTTTAAA GCGCCAGCCC  CAATAAAATC ATTCAACTTT GATTGTAAAA TTTTCATGTT AAAGCGCCAG CCGCAAGAAG CCTCAAAAAA ATTTGCGCGA GTAAAAAAAA GGTCACTATT GTGCCAATTT TAAATGAGTT  TAAACTTTAA TTGGGTTTAA TTTTAAAACA TCGGGCCAAT TTTAAATGGG TTTAAACTTT ACAAATGGGT ATTGGTGAGT AAAAGAGTAA TCAGCTTACT TTAAATGAGT TTTTAGTGTT  TAATGGGCTT AAGATAAATA AATGTTAATG GGTTTACGTG TTCAACAAAG TATACAAAAT TTTCTTTTTA AATATACATA TTTTAAAAAA AAATCGAGGA AGATTAGGCC CTAGGCCATC  ACCGTCCACC CCCCCTCCCC CCACCACCCC GGGGCTGGCC TTGTGTTAAT GGTTACGTGG TTTCACCTTA TAAAATACAT TCTTTATTTC AAATTTAAAC AGGTTAAACA TTTTAAAACG  AACACAACCC ACTTACTTAA ATGAGTTATA CACGTAAATC CAACACACAA CGTGTTTCCT AAATGTTAAA TTAGACATGA CAATCCAAAT CCTGATTATT TTTATGACAT GTCCATCCAT  ATATAGCCTT AACTATAGAT AAAATCATGA AACTAATCAG TTTTTGGATT GGACTTTTAG AGCTAAAGGA ATAATAAGGA GAGAATAGCC TCAAGAGAAA CTTGATATAA TACTGATTGC  CTAGGTCATA ACATGAGGCA CTCTTTATCG GGTAAATCTA CATTTGGCAA GTCGAGACAA ACTTGAAAAG TGAATCGAGT GCACGGCGGA CTCATGAACT TTTTCAACGG GGGTCAAAAG  TTTTTTTGTG GTTGATTGTC TATAACTATA TATTAAGTTT TCTTCGTTCC GATTCAAATT GAGTCGGATA GGGTCGGGTC AGGTGAAATA GTACAAAATC CCTACAGTAA CAACACAACA  TACACTATTG TTTTTTTTTT ACTATACTAT ATAACCAACT CCATATCACA CCAATTATCA TTATAACATC TTGCTTCACT ACCAATCATT CTTTGTGGAA AGAGTTATTT ACTGTTTTCG 
TCCCTGTGGT TTGTCAAAAA TAACTATTTC AGTCC 

Retrieve as FASTA