Entry information : HaPNC04 (HanXRQChr07g0202761)
Entry ID 13719
Creation 2016-05-13 (Christophe Dunand)
Last sequence changes 2016-05-13 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPNC04 (HanXRQChr07g0202761)
Name (synonym) HaPNC04 (HanXRQChr07g0202761)
Class Plantacyanin    [Orthogroup: PNC001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPNC04
start..stop
S start..stop
HaPNC21 185 3e-62 1..123 1..126
HaPNC19 185 3e-62 1..123 1..126
HaPNC13 185 3e-62 1..123 1..126
HaPNC10 185 3e-62 1..123 1..126
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 89096367..89096535 169 N° 2 89096678..89096877 200  
join(89096367..89096535,89096678..89096877)


exon

Literature and cross-references HaPNC04 (HanXRQChr07g0202761)
DNA ref. HanXRQ genome:   HanXRQChr07 (89096367..89096877)
Protein sequence: HaPNC04 (HanXRQChr07g0202761)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   123 (97)
PWM (Da):   %s   12966.15 (10317.8) Transmb domain:   %s   o10-32i
PI (pH):   %s   5 (4.63) Peptide Signal:   %s   cut: 27 range:27-123
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKGRGSAMMAMVVLCLVVVCEVAQAATYVVGDDNGWTFNVDGWEKGKNFNAGDVLVFKYAKGSHNVVAVDEGGYYGCDVSPSEAKVYTSGNDQITLVKGNNSFICSFSDHCNSGMRLLISA

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGGGAAGAGGCAGTGCAATGATGGCAATGGTGGTTCTTTGTCTAGTAGTAGTATGCGAGGTAGCCCAGGCAGCTACTTATGTTGTCGGCGATGACAATGGCTGGACGTTTAAC
GTCGATGGCTGGGAAAAGGGCAAGAATTTCAATGCAGGCGACGTCCTTG
GTATCCTCTCAACATCTTATTTATCACCACTTTAGATACATAATAATATGTGTTGATGATATTAACAACTT
TTTTTTTATTAAGTTAATAATATAATAGTTTGTATTTAATTACTTGAATTGTTATTATATGATTGTAACAGTGTTTAAGTACGCAAAAGGATCACATAATGTGGTGGCTGTGGACGAGGG
AGGCTATTATGGATGCGACGTATCCCCAAGCGAGGCAAAGGTGTACACAAGTGGAAATGACCAAATTACCCTTGTGAAGGGTAATAACAGCTTCATTTGTAGTTTCTCTGATCACTGTAA
TAGTGGCATGAGGCTTTTAATCTCTGCATCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGGGAAGAGGCAGTGCAATGATGGCAATGGTGGTTCTTTGTCTAGTAGTAGTATGCGAGGTAGCCCAGGCAGCTACTTATGTTGTCGGCGATGACAATGGCTGGACGTTTAAC
GTCGATGGCTGGGAAAAGGGCAAGAATTTCAATGCAGGCGACGTCCTTG
TGTTTAAGTACGCAAAAGGATCACATAATGTGGTGGCTGTGGACGAGGGAGGCTATTATGGATGCGACGTA
TCCCCAAGCGAGGCAAAGGTGTACACAAGTGGAAATGACCAAATTACCCTTGTGAAGGGTAATAACAGCTTCATTTGTAGTTTCTCTGATCACTGTAATAGTGGCATGAGGCTTTTAATC
TCTGCATCT

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATCCCACAAA CGAAAAGACA TAATCTCTAG TTTGAGTGAA CCATGGCTAA GGGAAGAGGC AGTGCAATGA TGGCAATGGT GGTTCTTTGT CTAGTAGTAG TATGCGAGGT AGCCCAGGCA  GCTACTTATG TTGTCGGCGA TGACAATGGC TGGACGTTTA ACGTCGATGG CTGGGAAAAG GGCAAGAATT TCAATGCAGG CGACGTCCTT GTGTTTAAGT ACGCAAAAGG ATCACATAAT  GTGGTGGCTG TGGACGAGGG AGGCTATTAT GGATGCGACG TATCCCCAAG CGAGGCAAAG GTGTACACAA GTGGAAATGA CCAAATTACC CTTGTGAAGG GTAATAACAG CTTCATTTGT  AGTTTCTCTG ATCACTGTAA TAGTGGCATG AGGCTTTTAA TCTCTGCATC TTAAACAACA AGATAATAGT ATTTGACTTT GAGTTATGGA ATAATGTGTT TCTTGCCTAT TTATTGTGTG 
TCTTGTTATA AAT 

Retrieve as FASTA