Entry information : HaUCC03 (HanXRQChr07g0205611)
Entry ID 13720
Creation 2016-05-13 (Christophe Dunand)
Last sequence changes 2016-05-13 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaUCC03 (HanXRQChr07g0205611)
Name (synonym) HaUCC03 (HanXRQChr07g0205611)
Class Uclacyanin    [Orthogroup: UCC003]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaUCC03
start..stop
S start..stop
HaUCC05 149 5e-46 4..189 7..164
AtUCC05 149 5e-46 20..138 24..139
ThasUCC05 139 5e-42 8..138 11..140
HaUCC04 115 7e-33 9..166 8..162
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 98883913..98884078 166 N° 2 98884185..98884636 452  
join(98883913..98884078,98884185..98884636)


exon

Literature and cross-references HaUCC03 (HanXRQChr07g0205611)
DNA ref. HanXRQ genome:   HanXRQChr07 (98883913..98884636)
Protein sequence: HaUCC03 (HanXRQChr07g0205611)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   206 (183)
PWM (Da):   %s   21682.75 (19146.3) Transmb domain:   %s   i7-29o183-205i
PI (pH):   %s   7.41 (6.92) Peptide Signal:   %s   cut: 24 range:24-206
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MANIVYLLLTLLTITTFATRCLATTYTVGDSMGWDISTDVDSWAKDKHFVVGDVLLFQFSSSHSVAEVNRDSYQGCNTTNVLQPSSSNGSTTFALTKPGDRYFVCGNRLHCYAGMKLHVVVDGKAAEGPVAAAPEPQAGGDSTTTTTATTTTATTTTTPTTTTTTTNTPSKNKKPSSLVPNSVVSVPTGLKSFVFVGFTCILSWI

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAATATAGTTTATCTATTGTTGACTCTTTTAACCATCACTACCTTTGCAACAAGATGTCTAGCCACAACCTACACGGTTGGCGACTCGATGGGCTGGGACATAAGCACCGACGTC
GATTCATGGGCCAAAGACAAACATTTTGTCGTCGGTGATGTTCTTT
GTTAGTATCCTATTTCTAAAAAAATATGTTGGTACTAAAATAACAAAATATGAACTTTTGTTTTGTGACTTTGT
CTTATGAATTCATATCTTTGTGCTTTTTGTAGTGTTTCAATTTTCATCAAGTCATAGTGTGGCTGAGGTGAACCGAGACAGTTACCAGGGGTGCAACACGACCAACGTACTACAACCGAG
TAGTAGTAATGGGAGCACAACATTCGCTTTGACAAAGCCCGGTGATAGGTACTTTGTATGCGGTAACAGGCTACATTGCTATGCTGGAATGAAGCTACACGTGGTTGTCGATGGAAAAGC
GGCAGAAGGGCCTGTAGCAGCAGCCCCAGAGCCGCAGGCTGGTGGCGATTCCACCACTACTACTACTGCTACTACTACTACTGCTACTACTACTACAACCCCTACCACCACCACCACCAC
CACTAACACCCCTTCGAAAAATAAAAAACCTTCATCACTTGTCCCTAATTCAGTCGTTTCTGTGCCTACCGGATTAAAGTCATTTGTTTTCGTCGGTTTTACATGTATCCTATCTTGGAT
TATT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAATATAGTTTATCTATTGTTGACTCTTTTAACCATCACTACCTTTGCAACAAGATGTCTAGCCACAACCTACACGGTTGGCGACTCGATGGGCTGGGACATAAGCACCGACGTC
GATTCATGGGCCAAAGACAAACATTTTGTCGTCGGTGATGTTCTTT
TGTTTCAATTTTCATCAAGTCATAGTGTGGCTGAGGTGAACCGAGACAGTTACCAGGGGTGCAACACGACCAAC
GTACTACAACCGAGTAGTAGTAATGGGAGCACAACATTCGCTTTGACAAAGCCCGGTGATAGGTACTTTGTATGCGGTAACAGGCTACATTGCTATGCTGGAATGAAGCTACACGTGGTT
GTCGATGGAAAAGCGGCAGAAGGGCCTGTAGCAGCAGCCCCAGAGCCGCAGGCTGGTGGCGATTCCACCACTACTACTACTGCTACTACTACTACTGCTACTACTACTACAACCCCTACC
ACCACCACCACCACCACTAACACCCCTTCGAAAAATAAAAAACCTTCATCACTTGTCCCTAATTCAGTCGTTTCTGTGCCTACCGGATTAAAGTCATTTGTTTTCGTCGGTTTTACATGT
ATCCTATCTTGGATTATT

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CAACAAATGG CAAATATAGT TTATCTATTG TTGACTCTTT TAACCATCAC TACCTTTGCA ACAAGATGTC TAGCCACAAC CTACACGGTT GGCGACTCGA TGGGCTGGGA CATAAGCACC  GACGTCGATT CATGGGCCAA AGACAAACAT TTTGTCGTCG GTGATGTTCT TTTGTTTCAA TTTTCATCAA GTCATAGTGT GGCTGAGGTG AACCGAGACA GTTACCAGGG GTGCAACACG  ACCAACGTAC TACAACCGAG TAGTAGTAAT GGGAGCACAA CATTCGCTTT GACAAAGCCC GGTGATAGGT ACTTTGTATG CGGTAACAGG CTACATTGCT ATGCTGGAAT GAAGCTACAC  GTGGTTGTCG ATGGAAAAGC GGCAGAAGGG CCTGTAGCAG CAGCCCCAGA GCCGCAGGCT GGTGGCGATT CCACCACTAC TACTACTGCT ACTACTACTA CTGCTACTAC TACTACAACC  CCTACCACCA CCACCACCAC CACTAACACC CCTTCGAAAA ATAAAAAACC TTCATCACTT GTCCCTAATT CAGTCGTTTC TGTGCCTACC GGATTAAAGT CATTTGTTTT CGTCGGTTTT 
ACATGTATCC TATCTTGGAT TATTTAAGAA CTTTGTATTG TTTTGAAGTT TGCTTTTG 

Retrieve as FASTA