Entry information : HaUCC04 (HanXRQChr09g0248931)
Entry ID 13723
Creation 2016-05-13 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaUCC04 (HanXRQChr09g0248931)
Name (synonym) HaUCC04 (HanXRQChr09g0248931)
Class Uclacyanin    [Orthogroup: UCC001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaUCC04
start..stop
S start..stop
HaUCC01 124 7e-37 8..180 7..183
ThasUCC02-2 120 5e-35 2..130 8..132
AtUCC08 115 4e-33 33..182 31..179
AtUCC05 111 2e-31 6..145 7..154
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 82469625..82469787 163 N° 2 82467953..82468335 383  
complement(join(82467953..82468335,82469625..82469787))


exon

Literature and cross-references HaUCC04 (HanXRQChr09g0248931)
DNA ref. HanXRQ genome:   HanXRQChr09 (82469787..82467953)
Protein sequence: HaUCC04 (HanXRQChr09g0248931)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   182 (160)
PWM (Da):   %s   18515.18 (16152.9) Transmb domain:   %s   i5-27o159-181i (i5-27o159-181i)
PI (pH):   %s   6.74 (6.22) Peptide Signal:   %s   cut: 23 range:23-182
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRIYPIGFVLLVLVTCGISCLAIDYTVGDSAGWSLSVDYSTWASGKKFNVRDSLVFNYGSSHTVAEVSADDYDKCNVANSIMSYSSSPTTVTLNKTGTHYFVCGVVGHCSGGMKVAVPVTGDGGSGGATPAPSGPDGSSSAKPTPTPSSGTGKVPASSSTISPVVIVWLISLVSLVLMFVL

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAATATACCCGATTGGGTTTGTGTTGTTGGTATTGGTTACTTGTGGCATATCATGTTTAGCCATAGATTATACCGTTGGAGACTCTGCTGGATGGTCACTTAGCGTTGATTATAGC
ACTTGGGCTTCAGGCAAAAAGTTCAATGTTAGAGATAGCCTTG
GTAACATTAAAATGTTTTTGTTTCTCTTTTTTCTTTCACATAATGTACAATAAACCAGTGGCGGATCTAGGATTCAC
GCCAAGCCGTAACGTTTTATAAATAAGCCGTAACGAAATCGAAAAAACATCAAATTTTTCCAAAATTTACACTAAAAACGTCAAATTTTTCCGAGCCAAGCCGTAGCGGAGGCTACCCCC
CGGTATACACTATGTCCGCCCCTGCAATAAACTGTCGGTTGTAAACGAGATGAGTCGAGCTAAGTTAGGCTCAAACTCAGCTAGTTTATAAACCGAGCTAACTTGGGATGAATAGTTTAT
TTTCACAAGTTTTAAAAATAGTAATTTTAGATTTCGCATATATAACCTCCCCCATGCTAAAAAAAATTACAAAAACCTCCCCCATGCTAAAAAAATTACAAAACAAGCTGAGTTTAGCTG
GGTTGTTTAAAAAAAGTAATTAATTGGGTTATAAATTAAATTAATTTAGGGGTGCAAACGAGCCGAGCCTTATCGAGCACGAACCAAGCTTGAGCCTAAAATAAAGCTCGTTTGTTTATC
GAGCTCGAGCTTGAGCCTCGCATGTGAAGCTCTTTAGACTCGTCGAGCCTTATCGACCCTTAGTGTAAACGAGCCAAGTCTAGCCGAGCTTATTTAAACTTGTTTACAAGACAACCTCGA
ACTTAAAAATAAGTTTATATAGTAAACGAGCCCTAGCCCAAGCTTCACTTATCAAGCTCGCGAGCCTAAAAAGTCTATTATTTATATTATTTTTATTTAATATATTAACTAATAGATAAT
AAACGAGCCGAGCTCGAGCTTGAAAAAATACAAACGAGCCGAGCTCGACTCGGCTCGTTTGCATCCCTTATAATTTTTATCTATCGATCAATCTATACATACACATTAAAATTTGGGCTT
TAATTTAAATGGGCCTAGTGGCATCTTAGGTTCGATTCTAACAATGGGGTTTTTCCCTGATTTATTGGGTTTCCTCCTAAATTGCTGTTAGTTATTATAGCCTAGCGGAGATGGATATGA
TCTGGTGATTCCGCTGATGGCACGATAATACTTTAGTGGTCCATCAATGATCCATATTTTCTGTTCAAAAAATGAAAAATTTAAAACGGGCCAACTAGCTTAACGAGCTGAGCTTACCTT
ACCTTTTCCGGCGTTACGCTTGTTTACAAACCGGCAGTTCATGATCTTTTCGAGCTACACTCGAGCTTTTTCCCTTCTCAACAACACTTAATTGTCATATGTTAATTATTATTTATTTAT
GGCTTTGACTAGTGTTTAACTATGGAAGTAGTCACACGGTAGCTGAAGTGAGCGCAGACGACTATGATAAATGCAACGTCGCAAACTCCATAATGTCGTACTCCTCCAGCCCCACCACAG
TCACTCTAAACAAAACAGGTACACACTACTTCGTTTGTGGTGTGGTTGGACACTGCAGTGGTGGGATGAAGGTGGCGGTTCCGGTGACCGGAGACGGTGGTAGTGGTGGTGCCACCCCAG
CTCCATCTGGGCCAGATGGTTCTTCCTCCGCCAAGCCTACTCCTACACCATCAAGCGGCACGGGAAAGGTTCCGGCATCATCGTCAACCATTTCTCCGGTTGTAATCGTTTGGTTGATTA
GTTTGGTTTCTTTAGTGCTTATGTTTGTTCTTGCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAATATACCCGATTGGGTTTGTGTTGTTGGTATTGGTTACTTGTGGCATATCATGTTTAGCCATAGATTATACCGTTGGAGACTCTGCTGGATGGTCACTTAGCGTTGATTATAGC
ACTTGGGCTTCAGGCAAAAAGTTCAATGTTAGAGATAGCCTTG
TGTTTAACTATGGAAGTAGTCACACGGTAGCTGAAGTGAGCGCAGACGACTATGATAAATGCAACGTCGCAAACTCC
ATAATGTCGTACTCCTCCAGCCCCACCACAGTCACTCTAAACAAAACAGGTACACACTACTTCGTTTGTGGTGTGGTTGGACACTGCAGTGGTGGGATGAAGGTGGCGGTTCCGGTGACC
GGAGACGGTGGTAGTGGTGGTGCCACCCCAGCTCCATCTGGGCCAGATGGTTCTTCCTCCGCCAAGCCTACTCCTACACCATCAAGCGGCACGGGAAAGGTTCCGGCATCATCGTCAACC
ATTTCTCCGGTTGTAATCGTTTGGTTGATTAGTTTGGTTTCTTTAGTGCTTATGTTTGTTCTTGCT

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAGTATTCAA TAAAGTATAG TCTCCACTTA CTAACCTCTT ACCCCTATAA AACCAGAACT CTTGCCATAA CTATTTGCAT CAATTAAGAT CTCATTCCCT CCCCCCACAA ATACATACCA  AAACCCACAC AATGAGAATA TACCCGATTG GGTTTGTGTT GTTGGTATTG GTTACTTGTG GCATATCATG TTTAGCCATA GATTATACCG TTGGAGACTC TGCTGGATGG TCACTTAGCG  TTGATTATAG CACTTGGGCT TCAGGCAAAA AGTTCAATGT TAGAGATAGC CTTGTGTTTA ACTATGGAAG TAGTCACACG GTAGCTGAAG TGAGCGCAGA CGACTATGAT AAATGCAACG  TCGCAAACTC CATAATGTCG TACTCCTCCA GCCCCACCAC AGTCACTCTA AACAAAACAG GTACACACTA CTTCGTTTGT GGTGTGGTTG GACACTGCAG TGGTGGGATG AAGGTGGCGG  TTCCGGTGAC CGGAGACGGT GGTAGTGGTG GTGCCACCCC AGCTCCATCT GGGCCAGATG GTTCTTCCTC CGCCAAGCCT ACTCCTACAC CATCAAGCGG CACGGGAAAG GTTCCGGCAT  CATCGTCAAC CATTTCTCCG GTTGTAATCG TTTGGTTGAT TAGTTTGGTT TCTTTAGTGC TTATGTTTGT TCTTGCTTGA GTTCCCTTGC CAGGAAAGAG GCAGTGCCAT TAATTTCTCT  CTCCGTTGTG TTCCGATTTT TATTTATGTA ATTGAATTGA TCAGTAAATA ATGTGTTATA TCTGATGTGT TTTGCTATTC AAAAGGGGTA GCGGAGCAGT TTGTTGTCTG TTTACCAACT 
ATCTTAATAC AAATTCATAA TACAGTATTT TAAAAAAAA 

Retrieve as FASTA