Entry information : AtMSD01 (AT3G10920/ATMSD1/MEE33)
Entry ID 13734
Creation 2016-05-24 (Christophe Dunand)
Last sequence changes 2016-06-21 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-10-20 (Christophe Dunand)
Peroxidase information: AtMSD01 (AT3G10920/ATMSD1/MEE33)
Name (synonym) AtMSD01 (AT3G10920/ATMSD1/MEE33)
Class Mn SOD    [Orthogroup: MSD001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtMSD01
start..stop
S start..stop
ThasMSD01 406 2e-146 1..229 1..231
HaMSD01 389 1e-139 1..229 1..224
HaMSD02 383 2e-137 1..229 1..226
AtSDL01 330 3e-116 25..228 30..233
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..295 295 N° 2 774..820 47 N° 3 901..1026 126 N° 4 1138..1194 57
N° 5 1314..1391 78 N° 6 1475..1567 93  
join(1..295,774..820,901..1026,1138..1194,1314..1391,1475..1567)


exon

Literature and cross-references AtMSD01 (AT3G10920/ATMSD1/MEE33)
Cluster/Prediction ref. Genebank:   820263
Omic ref. AtProteome:   At3g10920 ATTED-II:   At3g10920 e-FP Browser:   At3g10920 TAIR:   At3g10920
Protein sequence: AtMSD01 (AT3G10920/ATMSD1/MEE33)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   232
PWM (Da):   %s   25428.15  
PI (pH):   %s   8.84
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAIRCVASRKTLAGLKETSSRLLRIRGIQTFTLPDLPYDYGALEPAISGEIMQIHHQKHHQAYVTNYNNALEQLDQAVNKGDASTVVKLQSAIKFNGGGHVNHSIFWKNLAPSEGGGEPPKGSLGSAIDAHFGSLEGLVKKMSAEGAAVQGSGWVWLGLDKELKKLVVDTTANQDPLVTKGGSLVPLVGIDVWEHAYYLQYKNVRPEYLKNVWKVINWKYASEVYEKENN*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGATTCGTTGTGTAGCGAGTAGAAAAACCCTAGCCGGCTTGAAGGAGACATCATCGAGGCTATTGAGGATCAGAGGGATTCAGACTTTTACGCTTCCTGATCTTCCTTACGATTAT
GGCGCATTGGAACCGGCCATTAGTGGAGAGATCATGCAGATTCATCACCAGAAGCATCACCAGGCTTATGTTACTAATTACAATAATGCTCTTGAGCAGCTTGATCAAGCTGTGAACAAG
GGAGATGCTTCCACTGTTGTTAAGTTGCAGAGCGCCATCAAATTCAACGGCGGAG
GTGTGTTTGTGTGTCTGACTCTCTTTTTTTTTTTTTTTTACGATCTCGATTTCTATGTGTTTGAT
CGATTGGTTTGTGTTTAGATCGTGTTTGGATGATATTAGCAAATGAAGTAGTTGATTTAGGAGAGAAATTTGGTTTGAACAGTGAAGCTGATGAGTAATTTTGATGAATTGGGATGAAAC
TTCTGTAAGAATCAATGAAACTTTTATCGGTAATGCAAGCTTTCTTAGATAGCTACTTTTGTTTGCTGGGTCTTGAGATCATAACCAGTTGATTTAGTATAGAACTTTTGTTAGGAACAT
TGAAGCTGTTGATTAATTTTGATGACTATAGTTTGGTATTAGGATTGTTGCTTCTTGAGCTCCGGACCGGTTGGATTGATAGAAGAGAAATTGGCAGAGAAACTATTGGAAATAAATTGA
GTTTTTTGTGTGCTAGAGAATGGGAATTGATCGACTTTATTTCTAACGTGCAGGTCATGTCAACCATTCGATTTTCTGGAAGAACCTTGCTCCTTCCAGTGTGAGCTTGTGTTTTGAGTT
TCTGTGTATTTCTTCGATTTTGTTGTTCTGTAATTGATGGTTTGTTTTAATGTATAACAGGAAGGTGGTGGAGAGCCACCAAAAGGATCTCTTGGTAGTGCCATTGACGCTCACTTTGGC
TCCCTTGAAGGTCTGGTGAAAAAGATGAGTGCTGAGGGTGCTGCAGTGCAAGGCTCAGGATGGGTG
GTCTGTAGTCTAGTTTCACCTTTTTATTTCATCTGCTCACATTGTCGACTCTGG
TGCTTTACGTATAATAACCATGGTCCTTGATTCGCTTGTTTCTGTTGATTAATTCAGTGGCTCGGACTAGACAAAGAACTGAAGAAGCTAGTTGTTGACACAACTGCCAATCAGGTAACT
TATCCATGATCAGGAATGCGCTATTGAATATGTTCAAAAGATTTCTTGGTACTCATGAACATCTGTGAGAATAATGGGTTTTAAAGAAAAAGAGTTTGTTTCGGTTGGTGCAGGATCCAT
TAGTGACAAAAGGAGGAAGCTTGGTACCTCTGGTGGGTATAGATGTTTGGGAGCACGCCTACTACTTGCAG
GTAACAACACTTTTGATACCTTAAGTCTCATGAGTTAGCTTAAAAGATT
AAGCTCTCTAATCAATCTGTATTCTCTCATTCAGTACAAAAATGTGAGGCCTGAGTATCTGAAGAATGTATGGAAAGTGATCAACTGGAAATATGCAAGCGAGGTTTATGAGAAGGAAAA
CAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGATTCGTTGTGTAGCGAGTAGAAAAACCCTAGCCGGCTTGAAGGAGACATCATCGAGGCTATTGAGGATCAGAGGGATTCAGACTTTTACGCTTCCTGATCTTCCTTACGATTAT
GGCGCATTGGAACCGGCCATTAGTGGAGAGATCATGCAGATTCATCACCAGAAGCATCACCAGGCTTATGTTACTAATTACAATAATGCTCTTGAGCAGCTTGATCAAGCTGTGAACAAG
GGAGATGCTTCCACTGTTGTTAAGTTGCAGAGCGCCATCAAATTCAACGGCGGAG
GTCATGTCAACCATTCGATTTTCTGGAAGAACCTTGCTCCTTCCAGTGAAGGTGGTGGAGAGCCA
CCAAAAGGATCTCTTGGTAGTGCCATTGACGCTCACTTTGGCTCCCTTGAAGGTCTGGTGAAAAAGATGAGTGCTGAGGGTGCTGCAGTGCAAGGCTCAGGATGGGTG
TGGCTCGGACTA
GACAAAGAACTGAAGAAGCTAGTTGTTGACACAACTGCCAATCAG
GATCCATTAGTGACAAAAGGAGGAAGCTTGGTACCTCTGGTGGGTATAGATGTTTGGGAGCACGCCTACTACTTG
CAG
TACAAAAATGTGAGGCCTGAGTATCTGAAGAATGTATGGAAAGTGATCAACTGGAAATATGCAAGCGAGGTTTATGAGAAGGAAAACAACTGA

Retrieve as FASTA