Entry information : HaCCS01 (HanXRQChr02g0047721/CCS)
Entry ID 13740
Creation 2016-05-24 (Christophe Dunand)
Last sequence changes 2016-05-24 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaCCS01 (HanXRQChr02g0047721/CCS)
Name (synonym) HaCCS01 (HanXRQChr02g0047721/CCS)
Class Copper chaperone for SOD    [Orthogroup: CCS001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaCCS01
start..stop
S start..stop
ThasCCS01 392 4e-138 3..315 4..321
AtCCS01 382 3e-134 48..315 51..320
MpCCS01 313 2e-106 78..311 127..363
KflCCS01 223 9e-73 83..312 30..253
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 126354600..126354824 225 N° 2 126354912..126354938 27 N° 3 126355584..126355656 73 N° 4 126355734..126355868 135
N° 5 126355947..126356170 224 N° 6 126357322..126357582 261  
join(126354600..126354824,126354912..126354938,126355584..126355656,126355734..1 26355868,126355947..126356170,126357322..126357582)


exon

Literature and cross-references HaCCS01 (HanXRQChr02g0047721/CCS)
DNA ref. HanXRQ genome:   HanXRQChr02 (126354600..126357582)
Protein sequence: HaCCS01 (HanXRQChr02g0047721/CCS)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   315
PWM (Da):   %s   33283.92  
PI (pH):   %s   6.15
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGFLRTVAAASTTTAITAALTLNSISPSSSSSHNNHNFTKPFFNQPFSSPNRFGLIKNLTSPPSALHMDTKQAPKLDAELPEVMTEFMVDMSCEGCVKAVKNKLQTVNGIKSVDVDLSNQVVRIFGSSPVKTMAEALEQTGRKARLIGQGLPGDVLITAAVAEFKGPQIFGVVRLAQVSMELARIEANFSGLSPGKHGWSINEFGDLTRGAASTGKVFNPVNQLSEEALGDLGTLEADENGEAFFSGVKKNLKIADLIGRAIAVYENEDRGDAGLAAAVVARSAGVGENYKKLCTCDGTTIWEATNADYVSSKV

Retrieve as FASTA  
Remarks SOD copper chapperone containing two domains: Heavy-metal-associated domain (HMA) and Copper/zinc superoxide dismutase.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTTTCTTAGAACAGTTGCAGCAGCGTCAACAACTACGGCCATTACAGCAGCACTCACCCTTAACTCCATTTCACCATCTTCATCCTCATCACACAATAATCACAACTTCACAAAA
CCCTTTTTCAATCAACCCTTTTCATCCCCAAATCGTTTCGGCCTCATCAAGAATCTCACCAGCCCCCCTTCTGCTCTTCACATGGACACTAAACAGGCTCCAAAG
GTTGCAACTTTTTGC
TTCAATTTGAACAATTGAATTGAGTTCAATATGGGTTTTGGTTTTAATTTGTGGGTTTTTGTTTTCTTGCAGCTTGATGCGGAATTGCCGGAAGTTATGGTGCGTTTTTTTTTTAAAATT
ATTGTTTTTCTGTTGGGTTTTTGATTGGAATAATCTTGTGGTTTCTAGGGTTTCTTTGTTAATTTGGGAATAGTTAAGTTGATATGGATTGGTTAATAGAAATTAACAGAAACTAGGGGT
GTTGATCGTGTTTATTATTCGGGTTTCGGGCAGTTCGGGTGGGGTTTTTTTGTGTATGATGCTGTATCTGATAACCGATCCATATCACTATCAGGTTCAGTCGGGTTGTTTGGTTATCGG
GTTATCGGGTCTGGTAGTTCGAGTTTGGACATATTTGTTAATAACTCTCTTACTATTTGGAAAGTTATGTTTACTCAGGAATTCTTGATAACATGCCAAACGAAACCAATGTAATTCGGG
TTTTGGGTTAATCAGTTTGGTTTATTTGAGTTTTTGATGTTTATATAGGTCGATTTGGCACCCGGCCCTAATAACAATCGGTTTAATCGGTTTTCGGGTAACAGGTTTGTTCGGGTTGGG
TTAATCGGGTATGGGTGAAAGCGGGTCAGGCCGTCAAGTTACTCGGGTATGGCTAAAATCGGCGTGCCTAAACAGAAACCTTAAAAATTGAAAATGTGGGATTAAGTTTTGGTAATCTGA
GATCTTGTATTCCTGCAATTACAGACAGAGTTCATGGTGGATATGAGTTGTGAAGGTTGTGTTAAAGCTGTCAAGAATAAGTTGCAAACAGTCAATGGTCAGTATTATGAGCACGATCAC
ATTACAGTTGGTGTTTTATGTGTTTAACATCTTGTTTATATTATGTTCTTATAGGAATTAAGAGCGTTGATGTGGATTTGAGCAATCAAGTAGTTAGAATTTTTGGGTCTTCACCGGTTA
AGACCATGGCTGAAGCCTTGGAGCAGACCGGTAGGAAAGCCCGGCTAATTGGTCAAGGGTTACCAGGAG
GTTAGTGAGTCAAATAATTCATTTCAAAACACATTCAAAGACCCTCTAAAC
TCTCTTTCTGCCCATTTTGCCATTCAGATGTCTTAATTACTGCTGCTGTTGCTGAATTCAAAGGCCCACAAATATTTGGGGTGGTCCGTCTGGCCCAAGTGAGTATGGAATTGGCTAGAA
TCGAAGCCAACTTCAGTGGGTTGTCACCTGGAAAACACGGTTGGTCCATCAACGAATTCGGTGATCTTACTCGAGGTGCCGCCAGTACTGGCAAAGTGTTTAATCCTGTTAATCAGCTCT
CAGAAGAAAAG
GTCAGATTTTATTAACATATCAATAACTTTTAATTGGTGTAGTGTAGGCTGTTTATTATACGGTTAATACCATATCCCTGAACTTAATTTTGGTATATTAAAGTCCCAA
ACTTGTCAAAAATACACACAAAAAGTCCCTCAACCTAATATCGGTATATTCAAGTCCCTAAACTTTTGTATAATGCATGTACATGTGAAATAAAAATAAAATAATGACTTATTACCCACC
AGTAAGGGTGTAAATGAGCCGAGCCGAGCCGAGCCGAGCCTGAGCCTTCTACTACTCGAGCTCGGCTCATCATATTTTTTGAAGCTCGACCTCGGCTCGGTTCCAGCCTACTATTTTGAG
ATCGAGTTCGGATCGCAAGTAACACCCAAAGATCGAGCTCGGCTTGGCTCGAGGTAATTTGAGAACTATCTCAAACAAGCTAAAAGCTCGGCTCAAGCTCGCTTCGATATAGCTTAAACG
ATCCAAAGCTCGTCTCGCCAATGTTACAATAGTTGTATTTTATATATAAAAATAATTTAAAATTACGTTTGGGCTTGCAGGCCTAAGCGAACTTTGTATGTCTAGCTCGAGCTCGGACTC
GATAACCAAAGTCCAAACGAGTCATGTTTTAAGCTCGGGCCCGGGCCCGGGCTTGTTTGAGCTTTTTATCAATCTGATCCCGAGTAGCCCTCAAGCCGCTGTGCATCGTTCACACTCCTA
CCCACCAGTCAAAATTAGATAAAGTGATATTCAATACTTTTTGCACAAAACAATTCAGACCATCTTATTTTTATCAATTTAAGAGCTAACAAGTTATGCTAAAAAAACTTATTAGTACGT
TCATTTTTATACAAATTTATTGACTTTTTAATATGCTAATTAGAGACTTTTTCGTGTATATTTTACAAGTTTAGGTTAATTGAATTTCATATACTAAAATTGGAGACTTATTTGTGTATA
TTTTCAAGTCTAGGGACTTTAACATATACTAAAATTAGAAACTTTTTCGTGTATTTTTATAAGTTTAGGGACTTTAATGTACCAAAAATTAGTTTGGATTTTTTTGCAAAAAGAAAACGA
AAGTATGTTGGTTTTTTATGGCATTAACCTTTTCTTATATGAAAAAGTAAATCGTCTTCTGGTTAAATAATAATATATGTAGGCGCTCGGTGACCTGGGAACACTAGAGGCTGATGAGAA
CGGTGAAGCGTTCTTCTCGGGTGTGAAAAAGAACCTTAAAATCGCGGATCTTATTGGTCGAGCAATAGCGGTGTATGAAAATGAAGACAGAGGTGATGCTGGGCTTGCGGCAGCGGTTGT
AGCAAGAAGTGCAGGAGTTGGTGAGAACTACAAGAAGCTCTGCACCTGTGATGGCACCACCATTTGGGAAGCAACCAATGCTGATTATGTATCCAGTAAAGTT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTTTCTTAGAACAGTTGCAGCAGCGTCAACAACTACGGCCATTACAGCAGCACTCACCCTTAACTCCATTTCACCATCTTCATCCTCATCACACAATAATCACAACTTCACAAAA
CCCTTTTTCAATCAACCCTTTTCATCCCCAAATCGTTTCGGCCTCATCAAGAATCTCACCAGCCCCCCTTCTGCTCTTCACATGGACACTAAACAGGCTCCAAAG
CTTGATGCGGAATTG
CCGGAAGTTATG
ACAGAGTTCATGGTGGATATGAGTTGTGAAGGTTGTGTTAAAGCTGTCAAGAATAAGTTGCAAACAGTCAATGGAATTAAGAGCGTTGATGTGGATTTGAGCAATCAA
GTAGTTAGAATTTTTGGGTCTTCACCGGTTAAGACCATGGCTGAAGCCTTGGAGCAGACCGGTAGGAAAGCCCGGCTAATTGGTCAAGGGTTACCAGGAG
ATGTCTTAATTACTGCTGCT
GTTGCTGAATTCAAAGGCCCACAAATATTTGGGGTGGTCCGTCTGGCCCAAGTGAGTATGGAATTGGCTAGAATCGAAGCCAACTTCAGTGGGTTGTCACCTGGAAAACACGGTTGGTCC
ATCAACGAATTCGGTGATCTTACTCGAGGTGCCGCCAGTACTGGCAAAGTGTTTAATCCTGTTAATCAGCTCTCAGAAGAAAAG
GCGCTCGGTGACCTGGGAACACTAGAGGCTGATGAG
AACGGTGAAGCGTTCTTCTCGGGTGTGAAAAAGAACCTTAAAATCGCGGATCTTATTGGTCGAGCAATAGCGGTGTATGAAAATGAAGACAGAGGTGATGCTGGGCTTGCGGCAGCGGTT
GTAGCAAGAAGTGCAGGAGTTGGTGAGAACTACAAGAAGCTCTGCACCTGTGATGGCACCACCATTTGGGAAGCAACCAATGCTGATTATGTATCCAGTAAAGTT

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTCTCCATGG TTTTTCAACC ACAAGAGTGT CATCACATCA AGTCATGAAT GGCATGCATC CGGATGCCTC TAGAACCCAC ACCAGAATTT TAATAATAAT AATAATAATA CCTTAATATT  ATTATTCGAT TTTCATTAAA TTCGTCTATT CACAATGGGT TTTCTTAGAA CAGTTGCAGC AGCGTCAACA ACTACGGCCA TTACAGCAGC ACTCACCCTT AACTCCATTT CACCATCTTC  ATCCTCATCA CACAATAATC ACAACTTCAC AAAACCCTTT TTCAATCAAC CCTTTTCATC CCCAAATCGT TTCGGCCTCA TCAAGAATCT CACCAGCCCC CCTTCTGCTC TTCACATGGA  CACTAAACAG GCTCCAAAGC TTGATGCGGA ATTGCCGGAA GTTATGACAG AGTTCATGGT GGATATGAGT TGTGAAGGTT GTGTTAAAGC TGTCAAGAAT AAGTTGCAAA CAGTCAATGG  AATTAAGAGC GTTGATGTGG ATTTGAGCAA TCAAGTAGTT AGAATTTTTG GGTCTTCACC GGTTAAGACC ATGGCTGAAG CCTTGGAGCA GACCGGTAGG AAAGCCCGGC TAATTGGTCA  AGGGTTACCA GGAGATGTCT TAATTACTGC TGCTGTTGCT GAATTCAAAG GCCCACAAAT ATTTGGGGTG GTCCGTCTGG CCCAAGTGAG TATGGAATTG GCTAGAATCG AAGCCAACTT  CAGTGGGTTG TCACCTGGAA AACACGGTTG GTCCATCAAC GAATTCGGTG ATCTTACTCG AGGTGCCGCC AGTACTGGCA AAGTGTTTAA TCCTGTTAAT CAGCTCTCAG AAGAAAAGGC  GCTCGGTGAC CTGGGAACAC TAGAGGCTGA TGAGAACGGT GAAGCGTTCT TCTCGGGTGT GAAAAAGAAC CTTAAAATCG CGGATCTTAT TGGTCGAGCA ATAGCGGTGT ATGAAAATGA  AGACAGAGGT GATGCTGGGC TTGCGGCAGC GGTTGTAGCA AGAAGTGCAG GAGTTGGTGA GAACTACAAG AAGCTCTGCA CCTGTGATGG CACCACCATT TGGGAAGCAA CCAATGCTGA  TTATGTATCC AGTAAAGTTT AATCCAAACC GTTTAAACAC ATTTTGTTTG TTTGTTTGTT TTCAATAAAG TTTAATCCGA TACAGTTTAA ACTATACCTA GGTGTGATTT GAATGCAGAG  AGATTGTTTT ATGTCAATTT GATTGTATCT ACTTGTCTTT ATGTGTTGAT ATTATTGCAC CATCTCTATG TTAAGGGGTC AATGAGCAGT GGCGGATCTA GAAAACTTTC ATAGGGGTAA 
CGTCTTAAAA GAAAGGGGTA ACGAAATCGA AAAA 

Retrieve as FASTA