Entry information : HaCSD01 (HanXRQChr07g0190131)
Entry ID 13742
Creation 2016-05-24 (Christophe Dunand)
Last sequence changes 2016-05-24 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaCSD01 (HanXRQChr07g0190131)
Name (synonym) HaCSD01 (HanXRQChr07g0190131)
Class Cu/Zn SOD    [Orthogroup: CSD001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaCSD01
start..stop
S start..stop
HaCSD02 306 3e-107 13..197 32..232
LeCSD01 270 4e-94 45..197 1..152
AtrCSD02 265 5e-92 44..197 24..176
ThasCSD01 256 9e-89 45..197 1..152
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 26571290..26571408 119 N° 2 26573261..26573349 89 N° 3 26573413..26573517 105 N° 4 26573610..26573705 96
N° 5 26574460..26574491 32 N° 6 26574565..26574640 76 N° 7 26574726..26574799 74  
join(26571290..26571408,26573261..26573349,26573413..26573517,26573610..26573705 ,26574460..26574491,26574565..26574640,26574726..26574799)


exon

Literature and cross-references HaCSD01 (HanXRQChr07g0190131)
DNA ref. HanXRQ genome:   HanXRQChr07 (26571290..26574799)
Protein sequence: HaCSD01 (HanXRQChr07g0190131)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   197
PWM (Da):   %s   20480.07  
PI (pH):   %s   6.88
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVTFAICMYLYLYINQSACPNFSTTHSHTHTHNLCRGVLRSHTKMVKAVTVLNSSEGVSGTIFFTQEAGAPTTVTGDISGLKPGPHGFHVHALGDTTNGCMSTGPHYNPHGKEHGAPDDEIRHAGDLGNVTVGEDGTAKFTIVDKQIPLIGGQSIIGRAVVVHADPDDLGGGHELSKSTGNAGGRVACGIIGLQ

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGACCTTTGCTATATGTATGTATCTATATCTATATATCAATCAATCGGCGTGCCCTAATTTCTCGACTACTCACTCACACACACACACACACAATCTTTGCAGGGGTGTTCTGAGG
TAAAATTGAATCTTTTTTCGCTTTTCTTTGATTCTGATCGTTGTATGTATGTGTATTTGATCTTGTAATCTGTTGTATCGAAATCGAATTTGATTACGATGTGTGTGTTATTCTTATTTT
GTTTGTATCGCTTTTGATTTGATTTAGCTTGATTTTCGTACTTTCGATTATAAATTTATAACCGATTTGATCGAGATCAGTGAATTTTGACTTGGATCATTTCAATCTAGAAGTGGTGCA
TGCGTTCATCTAATAGTAAATCTAGACAAAAGTTTAAGTTAGTGATTAGGTAACAATCATGTAATGGAAATCATGTTGTGTTATTGGATGATCGGTTTCTATTAAGTGGAAAACTAGGTT
TTTAAATGTTCTTATGGAGAATTGATTGAAATCAAAGGACAGAGGTTGAAATCTCAAATGGATGGGGACTTGTGTTTTTGTTTACAAGTGTTGCTGTAGAGAAAATTTGAGTTTATGTTT
TAAGTAGGGCTGGTCAAAAAGCTCGCGTCTCTGAGCTTGCTCGGAAAAGGCTCGCTCGATATGGCTCGGTTTGAAAGTGAGCCTAGCTCGGCTCGTGATGAGCCAAATTGGCTCGGTTTG
GCTCACTTGGTAGCTCGGCTCGGCTTAGCTCGAATTTTTTTTACTTATATTATATTTTATTTTTATATACATATAATATATTAAAAAATAGTGATTATTAATTACATTTAGTTAGGCTTG
TAGTTTGATATCTATGACATATTTAAAGGTTGATTTTCGTGCTAATGAACAAATATTGTATTTAAGTGAAATATAGAACATATTTTGCGTTATTGAACGTGATTTTGGCTTGTAATTTAT
TAGGTTGAACTTATTTTGAATATGTTCTTTTGAAGTATTGAATAATATTTTAGAATACTAAATTTTGAGAGCTATGTATTATTTTTTTTTAAAATCGAGCCAAACCAAGCCGAGCCGAGC
CAGCTCGGTTTAAAACCAAGCCGAGCCCGAGCTTAGATTTTTAGCTCGGTTTCAAATCCGAGCTGAGCCGAGCCAGCTCGGTTTATAATCGAGCCGAGCCCGAGCTTGCCCTAGCTTGGC
TCGGCTCAGCTCATGAACAGCCCTAGTTTTAAGGAAAGGAATAGGTGTCAAGAATATATAGATATACTGTTCTGTCTCTCTTCTGTTTGAATGATTTTGCATTACTGTCTTGATATATAT
ATGTATATGCCATTTTCGGATACAAATCATTAGTCAAAATTCATTTACGTATCATATGATGACTTGATCTAGATCGTTTCTCTATATAATCGATCATAACCGAAAGTATGACGATCAAGC
TTAGTCAAAGTGAATGTTTATTTTTTAAATGGTTATTTTCTTCTTGTGGTTTTAGTTGCCTAAGCATATTAGTTAACATGCTTTTTGAGGGTTAGTAAGTTATGGGGCTTTGTGCTGAAA
TAGGCTAATGTAAGTAGAAGAACAAAGGGATTTTGTTATATATTACATGCACATAATCACATTTGTAAGTTGATTACTATATCGCCATCTTGTTTAGGGTGTGTGAGACAAAGCAGATGC
TCATAGCCTTATTATATCCGCTCAATTAAACTTGCCTGCATGGCTGCATCCATTCCCAATAGTGAAAAGTTATGTTTGTAATTGTAAATCATATACAATTTAGATTTATTTGTTACCTGG
ATACTTAATTCTTGCAAAGCTCCGTTAGGTTGGTGGTGTCGAATCAAACATTTAAGTCAATCATCAAAGAGTCTAAACCTAAATATTGTAAATTGATATCAAAATCATCGGTCGGAGAGT
TATATGCGCTTCATGGATAATATCTGCTTATTCATTTTATCACTTGTTTAGATCACATACAAAAATGGTGAAGGCAGTCACAGTTCTTAACAGCAGTGAAGGTGTTAGTGGCACCATTTT
CTTCACTCAAGAGGCAGAAG
GTAGTTATTTACGTATTGAAGTTTGATAAACAGTTTAAGTATCTTACTTGATTGACGTTGCAGGTGCTCCCACAACTGTTACTGGTGACATTTCTGGCCT
TAAACCCGGACCACATGGTTTCCATGTTCATGCGCTTGGTGACACAACCAATGGATGCATGTCAACCG
GTATGTGTTCCTCACTAAAATTGTTAAAGTTGAGTCATTTGTGCTTAATGTT
GACATATCCAAACATTTAAACCTTTTCTTTCTGATGATAGGTCCTCACTACAATCCTCATGGAAAGGAGCATGGTGCCCCTGATGACGAGATTCGCCATGCTGGCGATCTTGGCAATGTC
ACAGTAGGCGAAGATG
GTATGCTTTATGTTTCAAGAATTAGCATTATGATCTTTGCCTCTGCAAGCTTTATACAAGATCGGTTTTCAAAATCTAATACAAATCAACTTTGCTTTGTTATT
TTTCGCTAGTTTATTGCTTTCAGCAATGTTTTCACCATCATATCTCTTCGTTAAATCATGGTCAATATGTGTGAAATTTTTTTCAGGATAATTTCATACCTTGCTCTTGGGGTACAAATG
TACAATATTATATTTGCTCAACAAAACAAATCATAATATCTGTTATCAAGTATGCCTGTTTTTTAAACTCTGAGATTTACACCCTTAGCTAATATTCATTAGGATATTAGCTTTTGGAAT
GCAAGGAAAAACAGAAGGGTATAATGGTCATATTATGAATTTTATATAATGAATTAGATTAATACGGATTTTTAAGCATTTGGGATGTCGGATATTTAGTAATAATTTTTTTAATTTAAA
AACGTTTGATACTATGCAAGTATTTATATGAATGTATATGAAATTACCCCTTTTTTCTTGCTTTCACCTTATCCATGAGCTTCGATTCAATTTAAAATTAAGGGGAGTCAAAATTTCTAA
TGACAGTTCTGTATAATAAGTTATGGCTCTATTTGTATTTGCTTTGCTAATGACAAAATTACGCAAATTTTATTTGAACTTTCAAAGACTATGAATGGAGAGTGAGAAAAATGTGAGCTC
TGTAACTAATACCTACTACTAACTTCTTATGGCTTTCTCATTGAACTCAGGTACTGCAAAGTTCACCATTGTTGATAAGCAGGTTGGTTCCTTTTTGAAATTGAAGTTTGATACATGTTT
AAGCATGCCAATTTAAGACGTAAAAATTCATGCAGATTCCACTAATTGGAGGTCAATCCATCATTGGAAGAGCTGTGGTTGTCCATGCTGATCCTGATGATCTTGGAAAGGGTAAACTTG
AGTTTTTTTAGTATCAAAACACATAGACATCCTTGCGGACACGTATCATAGATGTGAAGTTGTTTTAATCTTGCAGGAGGGCATGAGCTAAGCAAAAGCACTGGAAATGCTGGTGGAAGA
GTTGCATGTGGTATCATTGGATTGCAGGGT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGACCTTTGCTATATGTATGTATCTATATCTATATATCAATCAATCGGCGTGCCCTAATTTCTCGACTACTCACTCACACACACACACACACAATCTTTGCAGGGGTGTTCTGAGA
TCACATACAAAAATGGTGAAGGCAGTCACAGTTCTTAACAGCAGTGAAGGTGTTAGTGGCACCATTTTCTTCACTCAAGAGGCAGAAG
GTGCTCCCACAACTGTTACTGGTGACATTTCT
GGCCTTAAACCCGGACCACATGGTTTCCATGTTCATGCGCTTGGTGACACAACCAATGGATGCATGTCAACCG
GTCCTCACTACAATCCTCATGGAAAGGAGCATGGTGCCCCTGATGAC
GAGATTCGCCATGCTGGCGATCTTGGCAATGTCACAGTAGGCGAAGATG
GTACTGCAAAGTTCACCATTGTTGATAAGCAGATTCCACTAATTGGAGGTCAATCCATCATTGGAAGAGCT
GTGGTTGTCCATGCTGATCCTGATGATCTTGGAAAGG
GAGGGCATGAGCTAAGCAAAAGCACTGGAAATGCTGGTGGAAGAGTTGCATGTGGTATCATTGGATTGCAGGGT

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GTCTCTACGT ACTTTACACG CACCAATAAT AGTACGCGTC TAACATAAAC TCGCGCGTGT CCTGATGGGG TTAGGTAGTA GACTTTCAGG TCGGTCTTAA ATGGTGACCT TTGCTATATG  TATGTATCTA TATCTATATA TCAATCAATC GGCGTGCCCT AATTTCTCGA CTACTCACTC ACACACACAC ACACACAATC TTTGCAGGGG TGTTCTGAGA TCACATACAA AAATGGTGAA  GGCAGTCACA GTTCTTAACA GCAGTGAAGG TGTTAGTGGC ACCATTTTCT TCACTCAAGA GGCAGAAGGT GCTCCCACAA CTGTTACTGG TGACATTTCT GGCCTTAAAC CCGGACCACA  TGGTTTCCAT GTTCATGCGC TTGGTGACAC AACCAATGGA TGCATGTCAA CCGGTCCTCA CTACAATCCT CATGGAAAGG AGCATGGTGC CCCTGATGAC GAGATTCGCC ATGCTGGCGA  TCTTGGCAAT GTCACAGTAG GCGAAGATGG TACTGCAAAG TTCACCATTG TTGATAAGCA GATTCCACTA ATTGGAGGTC AATCCATCAT TGGAAGAGCT GTGGTTGTCC ATGCTGATCC  TGATGATCTT GGAAAGGGAG GGCATGAGCT AAGCAAAAGC ACTGGAAATG CTGGTGGAAG AGTTGCATGT GGTATCATTG GATTGCAGGG TTGATTATGC CAAATGGAAT CTGTGGTTTA  TGTTGGTCAA TAAAAGTAGT CTTGATGCTG CTTGATTATG TTTTGAGTGT ATGTTTTTTT TTTTAAAAAA AAGCTATGTT TGGCTCTTGA CATGAACACT TATTTTTAGA AAAATGGGTT  GCGTGTTTGT TTGAGAACTA TGTGAGTTTT TTATCTTGAC TTCTTTTATT AGGTAACGGG TAAAAAGTGG CACAAGTGTT TGTATGTGTA TACACAATTA TATATGTGTG TTTACCATAG  TGGCCCCGGA TATAACCCAA AAAATTAGGG GTGTCCCTAA AAAAATTGGT TAGTGTCTCA GCAAGTCAGT AATCAGTTTT TCCGGGAGTC ATTGGCCGCT TATTACTTGT ATAAATGTGG 
GCTTATTACT ATTAATTAAA TAATTATATA GATGTTAGTT AGATAGTTAA 

Retrieve as FASTA