Entry information : HaMSD02 (HanXRQChr08g0221521)
Entry ID 13743
Creation 2016-05-24 (Christophe Dunand)
Last sequence changes 2016-05-24 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaMSD02 (HanXRQChr08g0221521)
Name (synonym) HaMSD02 (HanXRQChr08g0221521)
Class Mn SOD    [Orthogroup: MSD001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaMSD02
start..stop
S start..stop
HaMSD01 432 1e-156 1..228 1..226
ThasMSD01 396 1e-142 1..228 1..233
AtMSD01 383 2e-137 1..226 1..229
AtSDL01 321 1e-112 16..227 24..235
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 49977255..49977540 286 N° 2 49976229..49976275 47 N° 3 49976026..49976151 126 N° 4 49975885..49975941 57
N° 5 49975440..49975517 78 N° 6 49974848..49974937 90  
complement(join(49974848..49974937,49975440..49975517,49975885..49975941,4997602 6..49976151,49976229..49976275,49977255..49977540))


exon

Literature and cross-references HaMSD02 (HanXRQChr08g0221521)
DNA ref. HanXRQ genome:   HanXRQChr08 (49977540..49974848)
Protein sequence: HaMSD02 (HanXRQChr08g0221521)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   228
PWM (Da):   %s   25266.01  
PI (pH):   %s   7.94
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALRTLATRKTLGAFSTFPQQLRGLQTFTLPDLAYDYGALEPAISGDIMQLHHQKHHQTYITNYNKALEQLDDAIAKGDASTAVKLQSAIKFNGGGHVNHSIFWKNLAPTEGGGEPPHGSLGWAIDQSYGSVEKLIAKMNAEGAAVQGSGWVWLAVDKELKRLVVETTANQDPLVTKGPSLVPLIGIDVWEHAYYLQYKNVRPDYLKNIWKVINWKYASEIYEKECP

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCTACGAACCTTGGCGACCCGTAAAACCCTAGGTGCATTCTCAACATTTCCACAACAATTGCGTGGATTGCAGACATTCACGCTTCCAGATCTTGCATACGATTATGGCGCACTG
GAGCCGGCGATTAGCGGCGATATCATGCAGCTCCACCACCAGAAACACCACCAGACCTACATAACTAACTACAATAAGGCTCTGGAGCAGCTCGATGACGCTATTGCTAAAGGAGACGCT
TCTACTGCTGTCAAATTGCAGAGTGCTATTAAGTTTAATGGCGGAG
GTTGAACTCTTAAATTTTATCATATATTATCTCAAGTTATGTAGCTGTTTGTAGTGATACTTGTATTTGATTAT
AGTGTTATTCATTTCAATTGCGGTTTATTGTTTACTTCTGATTTGTACTGGAAACGGAGTGATTTGAAGGTATTTAAGATGCACTTCTTAATTACAATAGAAAATGATTTTGACTTTGCA
ACAATATTAATGTTGAATTTTAATTTGAGAAGTAATTGTAGTTCTGTTTAGGTTGGTGGATGATTATAGATACTTATAGATTAAATATGAGATGTAAATTATGTAATAAGTGGTACAGTT
TTGATGCTAGAAGGATAACGATATCAATATTGATTTGAATACAACAAGTACTAGATTTTGCTTGTTAAAGCTTTAAACATGGATTTGTAATTGGGATGAAAGGAATGATTTTAGTCCCTA
ATCAAATGGTTTGAATCATAGTTGTCAAAGGTGCACTTAAGGCGCCAAGGGTGAGCGTGAGCCTTGGTCGGGCCTAGGTGTAAGGTGCTTAAAAAGCGAGGGCTCGATATAAGCAAGGCT
CATAGCATAAACGAACTATTTTTGGTGTTTTAGACATGTTCTAGGCTTTTTTTAGGGCTAGTTTAGGCCAGGCCTTTTTGCCTGGAATTTGCAGAATTTTGTCTGAATTATCAGGATTTG
GCCGGAAAACTCCCCAAAGGTCACCAGAGCGCCTGAATGGCAGCAAGGCGTGCCCCTGAAGGGCTTTTGACATTATAGGAATCGTGTGTATGACAACTGAGGTTCATCTCTCAGTGAGGC
AGAGGATTTCAGTTTTACCATCACAAGTATTGTTTAACGTATTATATTATTGTTGAAATAAGTAGCATACTTTGATGGGAAATGTTGTAAATGTTGTAGTGGTGTAAAAGCAAATATTTG
ACATCAGTTACTGTTCCAGTGCAAAGGTCCTAACTATTGATCTCTCCTTTTACGTTTCTGAGTAGGTCATGTGAATCACTCCATTTTCTGGAAGAATCTGGCTCCCACCAAGGTTAGTTT
ATTTTTAAGATTTTAGTGATAATTTGAGCACAGTAAGTTTACTAAGATAGAAAGTGAATTTTATTGCAGGAAGGGGGTGGTGAGCCACCACATGGCTCTTTGGGCTGGGCTATTGACCAG
AGCTATGGTTCTGTAGAAAAGTTGATTGCTAAGATGAATGCTGAAGGTGCTGCTGTTCAGGGTTCTGGATGGGTG
GTATGCACCTTGTCTCATTGCTAACTCGGTCATTTTCACATATAA
TAAAGAGTAATTAACTTTAAAATTGTATAACGTTGACAGTGGCTTGCAGTGGACAAAGAGCTAAAGAGGCTTGTGGTTGAAACCACAGCAAACCAGGTACATTAAGATAGTTTTAGTCTT
CTAGGCATCAAATGATATGTCTTCTGCAATTGCTACCTGTCCCAGCTCTAAATTTTTTGGCTTCCTCATTTCCTTGCTGATAATTTGTACCTTTTAATGATATGGCGTTAAATACTGGTG
TTTTATGCTTCTTTTAACAGCTTAGTATCCATATCTTTTTTTGCTTTTAGTGTTTCTGCCTTATGTATGAGATTAAGAATTACACCTTGTTTATTTTTTCCTTGATCCCCAGTTGACAGT
TGTCTCTTTCTTCAGATTAACAGTGATTTATACAAGTTAATGAAGTCATCATCCTCTTAATTACCTTCACTAATCAAGTTATTCAATATGAATTCTGCTGTAGGATCCACTGGTTACAAA
AGGTCCAAGTTTGGTTCCCCTGATTGGCATAGATGTTTGGGAGCATGCATACTATTTGCAG
GTAATCAAATAAAGATTCATTTTCGATATAAAGTGGCAGATAGAGGTTGTAAATTTGAC
CAATTTATGGGTAAATGGGTTGATTTGGGTTTATGCTTTCCTCGTAACGGGTGAATGTGTTACTAAAAAAGAAACTTGTTGAAACTTGAAAGCCACCAAAAGTGTAATAAAATGTGTAAA
CCTCTTGAATTTGTTTTTCTTAAAAAAGTTATTACTGAACTACATAGGTTTTTAAGCATATTTAGCACCTTAACTATTTATCGAATTCAAGAAGGAAAAAAACAAGTGTCTGCGGGTCAG
CCTGGCCCGTCTGGACTCATTTTGACTAGTTCCAACTTCCAAGAAATACGCGTGTAAACCCGTTTCTCAAATCGCCCAAATTGCCACCTCAAGTCCACCATCGAGATATGTGGAAAGCCC
TTCTAGAATGCAGTCTTAATTCAGTACTTGTGATCTTCCGTCTATATGTTTTAATTTTTGTATATCTTGTGTTCACTTTGCAGTACAAAAATGTGAGGCCAGATTACTTGAAGAACATAT
GGAAGGTGATTAACTGGAAATATGCGAGTGAAATATATGAGAAAGAGTGCCCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCTACGAACCTTGGCGACCCGTAAAACCCTAGGTGCATTCTCAACATTTCCACAACAATTGCGTGGATTGCAGACATTCACGCTTCCAGATCTTGCATACGATTATGGCGCACTG
GAGCCGGCGATTAGCGGCGATATCATGCAGCTCCACCACCAGAAACACCACCAGACCTACATAACTAACTACAATAAGGCTCTGGAGCAGCTCGATGACGCTATTGCTAAAGGAGACGCT
TCTACTGCTGTCAAATTGCAGAGTGCTATTAAGTTTAATGGCGGAG
GTCATGTGAATCACTCCATTTTCTGGAAGAATCTGGCTCCCACCAAGGAAGGGGGTGGTGAGCCACCACATGGC
TCTTTGGGCTGGGCTATTGACCAGAGCTATGGTTCTGTAGAAAAGTTGATTGCTAAGATGAATGCTGAAGGTGCTGCTGTTCAGGGTTCTGGATGGGTG
TGGCTTGCAGTGGACAAAGAG
CTAAAGAGGCTTGTGGTTGAAACCACAGCAAACCAG
GATCCACTGGTTACAAAAGGTCCAAGTTTGGTTCCCCTGATTGGCATAGATGTTTGGGAGCATGCATACTATTTGCAGTACAAA
AATGTGAGGCCAGATTACTTGAAGAACATATGGAAGGTGATTAACTGGAAATATGCGAGTGAAATATATGAGAAAGAGTGCCCT

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCAAAACTTA TCCGGTTCAA CAACAAAACC AAAACTTATC CGGTTCACCC CCAAATATTC TCTCCACAAC AAACAAATGG CTCTACGAAC CTTGGCGACC CGTAAAACCC TAGGTGCATT  CTCAACATTT CCACAACAAT TGCGTGGATT GCAGACATTC ACGCTTCCAG ATCTTGCATA CGATTATGGC GCACTGGAGC CGGCGATTAG CGGCGATATC ATGCAGCTCC ACCACCAGAA  ACACCACCAG ACCTACATAA CTAACTACAA TAAGGCTCTG GAGCAGCTCG ATGACGCTAT TGCTAAAGGA GACGCTTCTA CTGCTGTCAA ATTGCAGAGT GCTATTAAGT TTAATGGCGG  AGGTCATGTG AATCACTCCA TTTTCTGGAA GAATCTGGCT CCCACCAAGG AAGGGGGTGG TGAGCCACCA CATGGCTCTT TGGGCTGGGC TATTGACCAG AGCTATGGTT CTGTAGAAAA  GTTGATTGCT AAGATGAATG CTGAAGGTGC TGCTGTTCAG GGTTCTGGAT GGGTGTGGCT TGCAGTGGAC AAAGAGCTAA AGAGGCTTGT GGTTGAAACC ACAGCAAACC AGGATCCACT  GGTTACAAAA GGTCCAAGTT TGGTTCCCCT GATTGGCATA GATGTTTGGG AGCATGCATA CTATTTGCAG TACAAAAATG TGAGGCCAGA TTACTTGAAG AACATATGGA AGGTGATTAA  CTGGAAATAT GCGAGTGAAA TATATGAGAA AGAGTGCCCT TAAAAGGAGT TGTGGGTTCT GCAATAAGTC AAGAGAGTTA CAAAGCCCCA CCCTGTAAGA AAATGCTTCT GAGACCAGTC  TTCCTGTTAG AATAAATAGT GGTTCAACGA TTTGCTTACA TTTATGGTTG TTGCTTTTGC TTGTGTTATA AATCTCAAGT TTCTTTTGTA TGCAAACAAC TTCTGCAACT ACATTTGGCC  CAAATTATAT ATCCATGTGA TACTACTGGC TCAGCGATCA GAAACATGAA ATATGACTCA GGGGCTGTTT GGCAACTTCT GAATGGTTAA GTGCTGAACT AGTAAGAGGT CTGAACCATT  AAGGGCCGGT ACGATGCTTA ACTGTTCAGA GGCAAATGTC TGACCAATTC AGATTAGAGA CCTTAACCAT TCAGACTCAC GTAAAATGTT TAACCATTCA GAGGCAAATG TCGGAACCAT 
TCAGACATTT GCTCGCGA 

Retrieve as FASTA