Entry information : HaFSD02
Entry ID 13745
Creation 2016-05-24 (Christophe Dunand)
Last sequence changes 2017-12-08 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaFSD02
Name HaFSD02
Class FeSOD    [Orthogroup: FSD001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaFSD02
start..stop
S start..stop
HaFSD03 340 3e-120 2..199 50..255
HaFSD01 296 3e-102 2..200 50..271
AtFSD02 275 5e-94 2..192 53..266
ThasFSD01 266 1e-91 4..198 13..213
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 59089024..59089056 33 N° 2 59083386..59083746 361 N° 3 59083219..59083292 74 N° 4 59082273..59082299 27
N° 5 59081500..59081616 117  
complement(join(59081500..59081616,59082273..59082299,59083219..59083292,5908338 6..59083746,59089024..59089056))


exon

Literature and cross-references HaFSD02
DNA ref. HanXRQ genome:   HanXRQChr08 (59089056..59081500)
EST ref. GenBank:   CD847604.1
Protein sequence: HaFSD02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   212
PWM (Da):   %s   23920.21  
PI (pH):   %s   5.8
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MIDLKPPPYALDALEPHMSKETLEYHWGKHHRGYVNNLNKQIEGTELHEKSLESIILASYNKGDILPAFNNAAQVWNHEFFWESMKPGGGGKPSGELLELIIRDFGSFEALIQEFKLGAATHFGSGWTWLVYDIEHKKLAVLKTSNAINPLVLDYYPLLTLDVWENLRPDYIATFLDKLVSWDAASSRLDAAKVSIEGKKDGG

Retrieve as FASTA  
Remarks Complete sequence from genomic and EST. Shorter 5' but confirmed with EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATCGATTTGAAGCCACCTCCTTATGCATTGGTACGATAAATATATATAACTCAAAACTATACTATAACTTAAATAATCTATATATATATATATATATATATATATATAGGGGAAAGA
TAAATCGAAAACCCATGTGAGTTGAGAAAACCCTATGTAACATTTTTATTTTTTTTTAAAAAAAAATAGGAAATGTAATATAAATGTACACGGACCTATTTATGAAAAAAAAAATGAAAA
AAACGCTTACTATTTTTTAAAAAAAAAATGTTGAAAATTTATATGTTACATTTTTTTTGGACATACATATTATGTAACCTGAAATTTTGTAACATTTTAAAAAAAAAAAACTACTTGGTG
TTTTTTTGTGTTTCTTTTTTTAAAATGTTCAAATATATGTATATTACATTTCCTATTTTTTTTAGAAATGTATCTTGAGTTTACATGGTTTTTTTACAAAGGTTTTCTGAGTTTTCTCAA
CTCAAGTGGGTTTTCGATTTATCCTTCCCCTATATATATATATATACTAGATTATTAGACCCGTGTACTACACGGGTTTAAGGATATAAATTTATAAATTATTTAAATTTATATTCTCTT
CAAAAATTTACATAAGTGAATTTTTTACCATAGATAACGCAATAATTGGTCATGTGTAAAACCAATTCTTTGAGAAACACACCAACTTTACTTAGAGCATCCACAATAAGGCACTATTTA
GATGTTTTTAGGGAGGGAGAAAGTGATGTGGAGGAGAGAGGGTGTGAAGTGGAGGAGAGAGGATGTGAAGATGTTTGTGAGGAAAAATGAGAAAAAATAGATGAGTGTGAGTTATGTGAG
TGTAGTGAGGAGAGAGGAGAGAGGAGAGAGAGAGAGAAAATGTGTTTGTGAGAGGGGCAAGTGAGAGAAAGAATATGATTGGTTGGGCATGTGCCAACTAGGCACCCTAAAGAATGAAAA
AAAATGCCCCTTATTGGAGATGCTCTTAGAAATTGTTCTATACTTTTATTTATCGTCATGACAAAACATAAAGCGAGAGAAAACTGTCTTTTTTTTTCAATTTAAATGGAATCCTTCTAT
TTCGCGGTATTAAACGAAATCTAGGGATAAACGTTCAAGTGCAAGTATTAGTTCCGGATAATATGAGTGTCTCAATAACCTGGTCACCCAGTGATAGAACCTGTAGTCGAGTTCCATTAC
ATAAACCATTTTTTTGATCAATATTTTTGATAACGTCACTGGAACACTGAACTTTGGTAATTATCAATGGTTTGGCAAGCTTAAAAATATAACTCCATTTAGGACATCCGGTGAGTAAGA
CTTGCTTCAAAATTATTATGAAGATATTCTATCCTTAAACCCGTTTATTACACGAGTCTAATAACATTAAAAGTGTTTTCAAAGCACGAAAGTAAACCGGTTTTCAAATATCGGATTAAC
CCATTCTTTACCATTCTTATTATTATTATAATATAAAATTATAATTTATTTAATATATGTTTTAAACATATAGTAAAAAAAATCATTTTAAAGAATAAGAAGATGTTATCACATTGACAT
TATTTGAAATTGTTTATTATATAATTTATTTAATAGATGTTTTAAACATATAGTAAAAAAATCATTTTAAAGAATAAGAAGATGTTATCACATTGACATTATTTGAAATTGTTTATTATA
AGTAGAGTTACTAATAATTAACTATATATATTAGATAAGTCAAAAGTAAATAATCATTATCCATTTGTTAGTATTAAGTTCTTAAGGATTTTTTTATTGTTTTGTATTAATTAATTATTA
ATTAATTAGTAATAATAGTAGTAGTAAATTGAATGAAAGAATGCCATGTGGCATTAAGTTGCTCTTGTTTTAGTATAAGAATGCCATGTGGCATTAATCATACTTTTTTATTAGTATTAG
ATATATATGGGAAGGTTCATTTGAGAAGAAAATTTAATTGAGAAGAAAAAGAACAAAGGGCAATTTTGTAAAACATTAAGTAGTTTTTCACTTATCTCATTTATTATCATTTTTTACTAA
TTAATTAGTCATAAAGATTATTATCTTCCACACTAACTTTTTTTGCCTACACACATCAAAAAGTTGTCCTACATATTTCGAAATTCATCCTACACGTTGAAATTTATCTTACACAACTCG
TAATTTATTCTAAACAACTTCTAATTTATCCTACACTTTAAATTATTTTATTTTATTTTTTTGAAAAAATATATACTTTGAAGATAAGTTACAAAAAAATTTAATGTATTAGCTATTAAA
GAGGAAGACTACAAATTAATGACCTATGTAGATTTACCAATGTAACCTTATAGTAACATTAAATACTTATATTAAATGAAGTAAAATAAAGCATTCTTATTGGTTGAAATTTGTTCTTTT
TTCTTCTTACAAAAAATTTCTTCTCATTTGAACTCTCCACTATATATATATATATATATATATATAGGGTAGGGTTCCAGCGTGAACCTAATCCCATGCGTGAACTGCGTGAACTAATCT
GGACCATTGATTTCCTTTTTAGTTGTTAAAGGTATGATTGTAATTATATAAAAAATTAGATTTAAATCATTATTTTAATAATTGAATTAAGTTACATCTTTCCTAATTTAAATTCATTAT
CCACATTATCTTTTATTTCATTTTTATTTTTTAGATTTCACCACCAGAATTCGGATTATGATTTTTAAGATTCACGTAACCTTCAGATTTCAACAGTATACACATGTGTACTTTGATATG
AATTGAACAGTACACATGTGTACTCAGCATGGTACATATGTGTAATTAGCTACATAATAGATACATATAAACAAAACTTGTAAACTATTTTATATTAAGCAAATAACAATTTCCATAATG
TTTGCCAAACCAAAAAAAACATACAATTACAAGTTCCAGTTTCGTGAAAAAAATAAACGCAACATAGTCGGAAAAATAAAAAAGACATAGTCTTTTACAACTATTCGTCGCGTTGTATGC
TGAAACATCCTTATCGACCAAGCAAACAAACATACGTGAATCATCCTTATCGACCTCATACGTGAATCATCCTTATCGACCTTCCATCTCCACTTTCCTCGTTTACGACGTCTCCTATAA
TAACACAAAAAACTCAGCAATTAGTACTTTGCATAATTCACAAGTGTACATCAACAACTTTACATATTTAATACACAAAAAAATATGAGATATCACAAAACATACGCTATACACATATGT
ACATCGCATTAAAATCAGAGCAAAATCAGAATACACATGTGTACATCGCATTAAAAACAGAGAAAAATCAGAATACACATGTGTACAACGCGTTAAAAACAGAGCAAAATCAAAAAATTG
AACAAAAAACTGGGACATCACAAAAACAGACGCTATACACATGTGTACATCGCATAAAAACATAACAAAATCAGAATACACATGTGTACATCGCATTACAAACAAAGCAAAATCAAAAAA
AGTGAACTCCAACAAAACTAAACAACTTTCTGATATCATTTTCAAACTAATACAAATTAAACACATTCCTATCGATTCGAATGTCACCAAAACCCTAATTCCGTAAAACAAACTGAATCT
AAAAGAAAAAAAGCAACGTATTACGCATCAGTTCAATACAGAAAACACTACAACGTGAATCGTAACAATAATATATACGATTACATCTAAACTAATTGGAATTAAAGAGTTCAAAATTGA
ATCATAAAGTGAGTGCTTACGAAGAAAGGAGATACTTAGGTCTGAAACTCGGAAGAAATACGGAGACCGAAACCTCACAGCGGAGTGTCTAGTGCAGATCGTCGACGACGAATGGTGGAT
GCAGTAGGGATGGATGGAGTCGGACGGTGCTGATCGGAGGTATGAATCAATCGTTGTTTCGTCGGACGGGATTTACGCAGATCGGAGGGATTTATACTGTTTCGCCGGACAGGATTTATG
CTGTTTCGTCGGACAGGATTTATGCACTCATCTTGCCGCCGCCATGAATTTTCCGGCGATTTGCTTGATCTGACAGTGTTCCTCTTGTTTCCTTTGCCGTCGCCAATGAAGGTTAGAGAG
AAAGAAGTTCTGTGATTTTGATTAAGAGGGAATAAAGAAAATTGATAAACTAAACTGTAGCTATTTATGGGATTTAGGCTATGGAATAATATGGAAACTATTCAGTTTCCGAATTTTAAA
ATTTTTTTAATCAAAATTAATTCCATATCATTAAATTACTAATTAATGTAATTACACTTTTACCCTTTTCTATTTAATAAAATGCTAAAATATAACCAAATAATTACAATCATGCCACTC
ATTTAAAATCTCAAGATCATAAAAATCAATGGTCCAGATCAGTTCACGCAGTTCACGCATGTGATTTTGTTCACGTTTGAACCTAATCCATATATATATATATATATATAGGTAGAGGAT
CCTGTACATTAATCCAGAAGTGTGAGAAATGCATTATAGCACTATATAACACCATATAACAATATGTAACACCATATAACATTATGTAACACTATATAACACTATATAACAAATATAACA
CTATAGTTTGTCTGATAGCATGTCTATGATAGATGTATAGTGTTATATATTGTTATATAGTGTCATATAGTGTTACATAGTGTTATATGGTGTTTATATGGTGTTACATAGTGTTATATG
GTGTTATATAGTGTTATATATAGTGTTATAATACACTTCTCACACTTCTGAATTAATGTACACTATCCCTACCCTATACACATATATATATATATAGATATATATATATATTGCATTTTA
GTCTTCATATATATAGGCATGTCCAAACTTGCTAATCATGATTCAAAAATAAGCACCACCGGTTAAGACTGCTAGAATTTAGCCGACACATAAAACCTTTGAGCTTTTAGCTGCCAACTA
GGATTTAGCCTCCGCTTTAACCCCGACTAGAATTTAGCCTCCATTTTATCCGTGAGCTAGAATTTAGCCGCCTGCTTTTTATTTACCGGTTAGGATTTAGCCCCCGCTTTTTATCCGCCA
ACTAGGATTTTAGCTCACGCATTTTATCCTCCATCTAAATTTAACTCACGCTTTACACGTGTATTATTTTGATTGCTTTTTTTACTACTTTTCAAGGTTCTTGTGCTGGCTAATTTCTAA
TCGTCTCAGCCGGCAATGCTTATTTGTCGAATATTGATTGGTTGGTTTAGACATGTCTATTTTTATGAAGGCTAAACGCAGTGTTTATTTTGTTAATTTTGTCAGTCAAAAATGTCCATA
TTGTTAAGTTTTCCATAATTTAATTACTAGGATGCTCTTGAACCACACATGAGCAAAGAGACATTGGAATATCATTGGGGAAAACACCACAGAGGTTATGTCAACAATCTAAACAAGCAG
ATTGAGGGAACTGAACTACATGAAAAGTCATTAGAAAGCATAATATTAGCTTCATATAATAAAGGCGATATTCTTCCCGCCTTCAACAATGCTGCACAGGTTTGGAACCATGAATTCTTC
TGGGAATCTATGAAACCTGGTGGTGGTGGAAAGCCTTCCGGAGAACTTTTAGAATTAATAATCCGAGATTTCGGTTCGTTTGAAGCGCTAATTCAAGAGTTTAAGTTAGGTGCCGCTACT
CACTTTGGTTCTGGATGGACTTGGCTTGTAT
GTAAGTGTTGTGTTTGTTCCACCAAGATCCATGACCAAACAATTTGAAACAACATTGATCCATTAATTTTTAAAAGTCTTTGTTTATGT
GTAGATGACATAGAGCACAAGAAGCTTGCTGTGTTGAAGACCTCAAATGCAATTAATCCTCTGGTGTTGGATTACTATGTGAGTAAACAATAATATTATTTTCTTTTTGTTATATTGGTA
TTAAATTAATCATTAATTCTTGTATTAACCTTTGTATTATATCTCTTGCATATGTTTGTCATATTGGGGAGGGTTTATTTTAGAACCGCTTTTATTGCGAGAACCACGAGAACCAATGTG
AACACAACAAAATAAAAAGGGAAAATTACCAAAATGTTGGTTGACTAAGAGGGTTTTCAATTTTGTCACTCTCCTGCGTCATTGGAAGGACCACTGAGCATGGGATGAGTCGGCATATCA
TGTTGAAGAGTCCATGTATCACGCTTCTTCAGAAGAGTCCACCGACGCTTCGGAAGAGTCACCGACGCTTCGGAAGAGTCCACCGACGCTTCGGAAGAGTCACCGACTCTTCCCATAAAT
ATGTGGGACACGTGTCAGCTTCTAGGGACATGGACGCATCAACATAACATGCGGACTCTTCCGAAGCTTAGTGGTCCTTCCAAGGACGCAGGAGAGTGACAAAATTGAAAACCCTTTTGG
TCAACCAACAGTTTCGTAATTTTCCCAAATAAAAACCCACTCACAACCACCCAAAACCTAAACACCCCCCCCCCCTGGCGGCTAAAAAAAAAAAAAACTATACCTCACCCAAAAACTTAT
ACGAGTTGTGAGAATTTAAAGAACTCGGTCTTACGAAAGGTTTTTTCAAAAGTAGTGATAAGGTGGCAATGTTTTTCACTTTTAAGTGTTAAAAAATGGGTGTTTTTCTTATATGCGCTA
GCTAGGCATGCTTTTTAAAGTTTTTAGGTTTTGTTATTCTGGATGACTTAATTGGGCTACTTGCTTGGCGTAACATAAGCTATTGAGTAGTGTATATATATATGATATATTTATAATTAT
AATCTAACAATTGGTTTCTTTTTCTTGGACTTGCCAGCCGCTCCTCACCTTAGATGTTTGGGAGGTAGTTATATCTCTTCGCTTACATTTTCCACAATAAATAAACAATGTCCATGATAT
ATTCACTAACTTCAATTTGAAACTGAATTGTGATTGCAGCATGCATACTACCTGGATTTTAAGGCAAGAACTTGCTACTTTCTTCCAGATCGATGCACATATTTATCGGGGTGTTTGGAT
ATTTGCGCTATAAAACTGATTAATCGGTTACATATCTGCAAGACAAAAATTATTATTTAAGAAATATTAACATCATTAATTTATCCACATTTTCATTGAAATAATACTTCCAACATAATT
AATATGTAAGAATTATCTAAGCTAAAAATCATTTTCAATTCAATCTCTAAAAAAATACTTAGGTTTATTAGAAGAAGTCTTGAGTTTGAATACTTCAACAACAGATAAAAAAAATCCATT
TTAGTCATTTTATCTATTACTTCACTTAAGAAAAACTAGAACTATCACAGCTTCAAAAGGTTTGAAGCACATCAAATCGGTATCATATCATATTATTTACTATTTAGCATCAATAATGAG
TTTCAAAATGCATGTCCAAACACCCTCATTCACCATATGTATAAACAAAGTGACCCTTTAGCCTATCTAATGCTTGATTAGTGTCACAATAATGGTATTAAAATTAAAAGTCTATTGCAG

AACCTCAGGCCCGATTATATAGCTACTTTCCTCGATAAGCTTGTATCATGGGATGCGGCAAGTTCCAGACTCGATGCAGCCAAGGTTAGCATTGAGGGAAAGAAAGATGGAGGCAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATCGATTTGAAGCCACCTCCTTATGCATTGGATGCTCTTGAACCACACATGAGCAAAGAGACATTGGAATATCATTGGGGAAAACACCACAGAGGTTATGTCAACAATCTAAACAAG
CAGATTGAGGGAACTGAACTACATGAAAAGTCATTAGAAAGCATAATATTAGCTTCATATAATAAAGGCGATATTCTTCCCGCCTTCAACAATGCTGCACAGGTTTGGAACCATGAATTC
TTCTGGGAATCTATGAAACCTGGTGGTGGTGGAAAGCCTTCCGGAGAACTTTTAGAATTAATAATCCGAGATTTCGGTTCGTTTGAAGCGCTAATTCAAGAGTTTAAGTTAGGTGCCGCT
ACTCACTTTGGTTCTGGATGGACTTGGCTTGTAT
ATGACATAGAGCACAAGAAGCTTGCTGTGTTGAAGACCTCAAATGCAATTAATCCTCTGGTGTTGGATTACTATCCGCTCCTCACC
TTAGATGTTTGGGAG
AACCTCAGGCCCGATTATATAGCTACTTTCCTCGATAAGCTTGTATCATGGGATGCGGCAAGTTCCAGACTCGATGCAGCCAAGGTTAGCATTGAGGGAAAGAAA
GATGGAGGCAAT

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCCAACTTAA CACAACTTAT AATCATCCTA TTTCTACTGC AGAGAGTCTG CCTCCAATCT AAACCGTCAG GCTAGAAAAT CTGCTTCTGG AGCCATGATC GATTTGAAGC CACCTCCTTA  TGCATTGGAT GCTCTTGAAC CACACATGAG CAAAGAGACA TTGGAATATC ATTGGGGAAA ACACCACAGA GGTTATGTCA ACAATCTAAA CAAGCAGATT GAGGGAACTG AACTACATGA  AAAGTCATTA GAAAGCATAA TATTAGCTTC ATATAATAAA GGCGATATTC TTCCCGCCTT CAACAATGCT GCACAGGTTT GGAACCATGA ATTCTTCTGG GAATCTATGA AACCTGGTGG  TGGTGGAAAG CCTTCCGGAG AACTTTTAGA ATTAATAATC CGAGATTTCG GTTCGTTTGA AGCGCTAATT CAAGAGTTTA AGTTAGGTGC CGCTACTCAC TTTGGTTCTG GATGGACTTG  GCTTGTATAT GACATAGAGC ACAAGAAGCT TGCTGTGTTG AAGACCTCAA ATGCAATTAA TCCTCTGGTG TTGGATTACT ATCCGCTCCT CACCTTAGAT GTTTGGGAGC ATGCATACTA  CCTGGATTTT AAGAACCTCA GGCCCGATTA TATAGCTACT TTCCTCGATA AGCTTGTATC ATGGGATGCG GCAAGTTCCA GACTCGATGC AGCCAAGGTT AGCATTGAGG GAAAGAAAGA  TGGAGGCAAT TGATGTAATG CGTAAACACG CCACAATAAA ACCTATCACT ACACCCTTTG GTCGCCACAA TAAAACCTAC ACTACACCCT TTGGTCTTCT TCGCATTCCC TCATTATGGT  TAAGTATTTA TGATGTGTCT TCTTGGTTTG GTTTGCTTGT TTGATCTTCT AGCATTCGTA TTGAGTTGGG TTGGTCCGAA AATAACACAT GGACATTCAA AGTATTATTT CTTGTACTTT  TATATTTGGT GTGAGATCTC CCTGGTTTGA ATCGAACAAT AAACATAAAT CTTAGAAGGT AAATCTCATG AATAACAAAC AAAATACAGA AATATATCAT TGTAGATTTA GCATCAACCC 
CCATGGATTA TCCATGGGGT ATTACATCAA AGATCCATTA AGAAGATACT ATCAGATACA CACCTCCAAA TGATGGTCGC T 

Retrieve as FASTA