Entry information : HaCSD02 (HanXRQChr08g0227691)
Entry ID 13747
Creation 2016-05-24 (Christophe Dunand)
Last sequence changes 2016-05-24 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaCSD02 (HanXRQChr08g0227691)
Name (synonym) HaCSD02 (HanXRQChr08g0227691)
Class Cu/Zn SOD    [Orthogroup: CSD001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaCSD02
start..stop
S start..stop
HaCSD01 306 2e-107 74..232 39..197
LeCSD01 266 2e-92 80..232 1..152
AtrCSD02 266 7e-92 53..232 2..176
ThasCSD01 256 3e-88 80..232 1..152
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 90917858..90918030 173 N° 2 90917673..90917723 51 N° 3 90916153..90916241 89 N° 4 90915959..90916063 105
N° 5 90915772..90915867 96 N° 6 90915652..90915683 32 N° 7 90915486..90915561 76 N° 8 90914690..90914743 54
N° 9 90913851..90913870 20  
complement(join(90913851..90913870,90914690..90914743,90915486..90915561,9091565 2..90915683,90915772..90915867,90915959..90916063,90916153..90916241,90917673..9 0917723,90917858..90918030))


exon

Literature and cross-references HaCSD02 (HanXRQChr08g0227691)
DNA ref. HanXRQ genome:   HanXRQChr08 (90918030..90913851)
Protein sequence: HaCSD02 (HanXRQChr08g0227691)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   232
PWM (Da):   %s   24285.39 Transmb domain:   %s   o10-32i53-72o
PI (pH):   %s   6.75
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNRGECEVGRWHILIGKSLTATSIIIILLSIYNNNRRALSINQLLIHTHHQSICFAGVLIFVISVLYTTDFVEIRSHTNMVKAVAVLSSSEGVSGTIFFNQEAGAPTTVTGDLSGLKPGPHGFHVHALGDTTNGCMSTGPHYNPHGKEHGAPDDEVRHAGDLGNVTVGEDGTAKFTIVDKQIPLIGAQSIVGRAVVVHADADDLGGGHELSKSTGNAGGRVACGIIGLQ

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATAGAGGTGAATGTGAGGTAGGTAGGTGGCATATTTTAATAGGTAAGTCTTTAACGGCGACCTCTATTATTATTATTTTATTATCTATATATAACAACAATCGCCGTGCCCTATCA
ATCAATCAGCTGCTCATTCACACACATCATCAGTCGATTTGCTTTGCAGGGGT
GTTCTGAGGTCAATTCGAATCATCTTTTCTTAATTTTCTTGTATATTTCTATACCTATGTTTCATCT
TCTAATCTCGTTTTGTGTATCGATCGAAAACGAATTTGTTGATTTAGTTTTATTTTCATCCTTCCAGTTTGATCTTCGTAATCTCCGTTTTATACACAACTGATTTTGTGGAGATCAGGT
GACTTTGATGTGTTGTATCTAGATATTCATTTGTTAGGGTTTATGCATGTGAGAACAGTCTGATTGTAAATCTCGTCAGAATTAGTATTAAAGTGATTGATAAGAAAGAATATTTGATTT
AAATTGTTTAGTTACTTTTATCACAACTTTATGAAATATTGGATTTTAATAATCCCAACTATTAATTGGCCGTCCCAACTTCAAAAATAACCACTTGCAGCCCAACTATTGACAGAATCC
TAACGCCGTTAGTCTTCGGTCGCCGGAAAACCGTTTTTGGCCAGAAAAAGGTTTTTAAAGGTCCAATTGAAGGTTACAATGAGGTTTAGGACGAAAATGTTGAGTTTTCCGGCCGAAAAG
TTGAGTTTTCCGGCCAAAAAGAAGTTTTCCGGCGACTTCAATAATTGGGGCTTTTACTGGACAAAGGTTACTAATGGTCTGTAATAAGGTTAGAAAGAGGTTTGGGACAAAAATGTTGAG
TTTTCCGGGCAAAAATGAGTTTTCCGGCGACCGGAGACTAACCGCGTTAGGGTTCTGTTAGTCAGGGTCCATTGGAGGCCAATATGTTAATAGTTGGGAATGCCCGTGGTTATTTTTGAA
GTTGTGATGGTTGGTGGCAAACGGCGAATAGTTGGGATTATTAAAATCCAATATTCCTAACTTTATATATAACCATATTTATTATTATGTAAATATATATCAAATAAAATTTATATAGAG
GATAGGCTCATTTGGGCTAACAATCCTTTGGGATCACGGCTTGATTCGAGCTTTTAGTGACTTGATCTCGAGCATTTACACCCCTAATGGGGCGCTTCTGGGATGTAGAAATAGGCTAAT
ATAGAATTGAAGAACATGAATGTTGATTATGATGACATAATTAACATCTCTTTTGTGATGGTGTGAGACAAGCATATGCTCATAACCTTGTATAAGTTCTGCTCTGTGATTTAGATGTCT
AATACTTGAAAAGCTCTATCTTGGTTGTAAGAATTTAACATTTGGGCCAATCATCAAGGAGTTCTGCACTCGTATAAGATATTGACTTGGTTCAAAAAAGACGAACCTGAGGAAAATGCA
TCAGGGGAAAAAGACGTGCCTCTTATGTTATGGGTCCATAGTTCCATAGGAGCTATATATGTAAAAACAACTTAAGGAATTAAGAAATTATGAAAGGTTTATACTTTATAGTTTACTTGA
TAAATAGGTTTATATGTAAAACGGATGAGAGATATGCAACTTCTAGTTGTGAATGAAGCGTATTTGGTTGTACATAGTTTTGCGCCTCACGTATGTGATGCGCATCTTGGCTTTTGGGAC
CGAAATGCCTTGGAGCGTGAACCAACGATGTTGAATCCTGATATTTTGTATATTTTTTGGTCTATGAGCTGTAGGTGGTCTTTTAATATTTGGTTATTCAATTGTTTAGATCACATACAA
ACATGGTGAAGGCGGTTGCGGTTCTTAGCAGCAGTGAGGGTGTTAGCGGCACCATCTTCTTCAATCAAGAGGCAGAAG
GTGAAAATTGAGTTATATTCTAAATTTTGGTGTTGTATGTAT
TACTAATAAACATATTAGTTAATTTACTTAATTAACCGATGTCGCAGGTGCTCCCACTACCGTTACCGGAGACCTTTCTGGCCTCAAACCTGGACCTCATGGTTTCCATGTTCATGCACT
TGGTGACACAACCAATGGGTGCATGTCAACTG
GTACGTGTTCCTTAACGAAATCATTTAAAGTGAATTAGTCTGTGTGTCACGTGATATATCTTAACACCGAAACCGTTCCTTTTGATGG
TAGGTCCTCACTACAATCCTCATGGAAAGGAGCATGGTGCCCCCGATGATGAGGTTCGCCATGCCGGTGATCTTGGGAATGTCACCGTAGGCGAAGATGGTATACTTTACATTCAAGAAT
TAGGTTATTTTACGGGTTTATATAATTATTCTAATGTTAACTTCTCACGGGTTTCTTATTAACTCAGGTACTGCAAAATTCACCATTGTTGATAAGCAGGTGGGTTCCTCACTTCCTTGC
AGGATTTCATGCAATCGAATTTAATTACGCATTTGATGTAATAAATCTGAAATATGCCAACATGTGTAGATTCCACTGATTGGAGCTCAATCCATCGTTGGGAGGGCAGTAGTTGTTCAT
GCTGATGCTGACGATCTTGGAAAGG
GTAAACTTCAACTTTTTGTTTTTCATAATTAAACACATGTGTATATATTTGTATGTATATGTGTGTTATTGATTCTAAAACACTGGGTTTAGATG
AGAGACGTCTAATTTATGTACTTTTACCCTTGGTTTAAAAAAGCGCGCTTAAGCACAAAGCGACCCTAGGCGCAAAGAGTTGCGCCTTGTGTGACATAAAGCGAGCTCTGTACAAAAAGC
GCACAAAAAACGAGCTTTTTTGGAAAAAAATCCCACTGAGGCGCGTGCTTTTTGTACAGAAGGTGTTTTTGTGCTTTAAAGTGTTACACATGCAGCTAAAATGGTTGTACATTATATGAT
TTATACATTAAATCATATATAAACCTTATTTATTACTATATTTTGGGTAAGGGATGCTAAAAGCCTATATATATATATATATATATATATATATATATATATATATATATATAAGCACCT
TGGGCCTCACGTACGAAAAGCCCACCGCTTTTGCGATTTGCGCTTCACGCTTTGATTTTAGACCTTGTCGCTTTTGTGCGCTTCACGCTTTTTTAAACCAAGCTTTTACCGGATGGTTAA
GAATGGAAATTAACACCTTTTACACACATTGCACGAACTACGAAGGTTTAAGGCATGGCGTAGGCTTGTTCTTCTCTTTCTCTAGCAAATATATTGGGGATTATTTTCGTCCATTGTATG
TTTTGTTATTACAAAATCTAATCTATTTGAACTCTTTTATCTTTCAGGAGGCCATGAGCTCAGCAAAAGCACAGGAAATGCTGGTGGAAGAGTTGCATGCGGTAAGCTTCTCTCGTTTAT
TTTTTTTTAATTGTTTTCGTGTTTAAGAGGCAACCTTGCAAGTCCAATGAGAACTTGGAAGAATTGTAAAGGAAAGGAAACTGAAAGATCACACTTCTAAACCGGTTTTGATGAAAGTTA
TGGGCCCAACTCCACAATCGCCAACTACAGTTTTGGAAACAAAAAACCAAAACGGTTGGGTCAGATGGTTTGAACCGTTTTCTAATGATTAGTATTTCAAAATTGTTAGTTTGCATTAAA
GTTGTAAAATAATACATATAAATAACTGCATAGGGTTTGGTTCAATGGGGAACCGGGGAACCACTAATTTTACATGTAAAACAAATCATTAAAAAATCATTTTTACATAGTTTCTTTGGA
GCTTTTTCATAGAAGCCATTCAAATAAAAAACATTTTTACATAATTTCTTAGGAGCTGTTTTTGAACTGTTTTTTATACTATTTTTTATTTTACAAATTTTTTTTTATTAAAACAGCTTC
TACATGTGTTTATATGCAAAAGATTAGCATAAAATTAATTTTTTACCCATAAAAATGAATTTTTGAGTTTTTTTTACATGGTTCCCTAGTTTCCCACTTTTTTGTGGTTCCCTATTGAAC
CTCACACTAACTGCATATTCTAATAAATAATAAAGTTCCAAACAACAACTCATTAAGCCATCAAAACCAAGCGGTATAAATCTCAAACCTGCCGACTTGCTTTGGTGTAAGTGGTTCGGA
CGGTTTCAACTGTTTATGAACTCAAATGAGCGTGTAATCACCGATGGAGTTTCTTACATAGATGTTGGTGGTGTTTGTAGGTATCATTGGATTGCAGGGT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATAGAGGTGAATGTGAGGTAGGTAGGTGGCATATTTTAATAGGTAAGTCTTTAACGGCGACCTCTATTATTATTATTTTATTATCTATATATAACAACAATCGCCGTGCCCTATCA
ATCAATCAGCTGCTCATTCACACACATCATCAGTCGATTTGCTTTGCAGGGGT
TTTGATCTTCGTAATCTCCGTTTTATACACAACTGATTTTGTGGAGATCAGATCACATACAAACATG
GTGAAGGCGGTTGCGGTTCTTAGCAGCAGTGAGGGTGTTAGCGGCACCATCTTCTTCAATCAAGAGGCAGAAG
GTGCTCCCACTACCGTTACCGGAGACCTTTCTGGCCTCAAACCTGGA
CCTCATGGTTTCCATGTTCATGCACTTGGTGACACAACCAATGGGTGCATGTCAACTG
GTCCTCACTACAATCCTCATGGAAAGGAGCATGGTGCCCCCGATGATGAGGTTCGCCATGCC
GGTGATCTTGGGAATGTCACCGTAGGCGAAGATG
GTACTGCAAAATTCACCATTGTTGATAAGCAGATTCCACTGATTGGAGCTCAATCCATCGTTGGGAGGGCAGTAGTTGTTCATGCT
GATGCTGACGATCTTGGAAAGG
GAGGCCATGAGCTCAGCAAAAGCACAGGAAATGCTGGTGGAAGAGTTGCATGCGGTATCATTGGATTGCAGGGT

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATAGAG GTGAATGTGA GGTAGGTAGG TGGCATATTT TAATAGGTAA GTCTTTAACG GCGACCTCTA TTATTATTAT TTTATTATCT ATATATAACA ACAATCGCCG TGCCCTATCA  ATCAATCAGC TGCTCATTCA CACACATCAT CAGTCGATTT GCTTTGCAGG GGTTTTGATC TTCGTAATCT CCGTTTTATA CACAACTGAT TTTGTGGAGA TCAGATCACA TACAAACATG  GTGAAGGCGG TTGCGGTTCT TAGCAGCAGT GAGGGTGTTA GCGGCACCAT CTTCTTCAAT CAAGAGGCAG AAGGTGCTCC CACTACCGTT ACCGGAGACC TTTCTGGCCT CAAACCTGGA  CCTCATGGTT TCCATGTTCA TGCACTTGGT GACACAACCA ATGGGTGCAT GTCAACTGGT CCTCACTACA ATCCTCATGG AAAGGAGCAT GGTGCCCCCG ATGATGAGGT TCGCCATGCC  GGTGATCTTG GGAATGTCAC CGTAGGCGAA GATGGTACTG CAAAATTCAC CATTGTTGAT AAGCAGATTC CACTGATTGG AGCTCAATCC ATCGTTGGGA GGGCAGTAGT TGTTCATGCT  GATGCTGACG ATCTTGGAAA GGGAGGCCAT GAGCTCAGCA AAAGCACAGG AAATGCTGGT GGAAGAGTTG CATGCGGTAT CATTGGATTG CAGGGTTGAT CATATGCCAG GAAATAATCT  GACTTCGACT ATCCTCAAGT GTTGGTATTA CTTCGTTTAA TAAACCGATG CTCTGTGTTA GTTGAATACT CCGATGATAT TTCGAGTTGA GACGTGTTTT GTGCAATGAC GAATACTTTG  GGCTTTTGAA TCTGTAGACC AACTTTATAA TAAAAATAAA TCACTTTTTT AAAAAATATT TTGTTTGAAG GGTTCTGGCC AAAAGCAGGT AAATATGTTG CATCTTCACC ATGCTTTTCT 
AGCTATGTTA AATTCAAGGT GATTCGTAGA AGATAATAAG GAGTTGTTGC TTGACAACTT GGTGGTAAAA CCAATATTTT GCTCGTATTT TGATTTGTTG AGTTGCATGA TA 

Retrieve as FASTA