Entry information : HaCSD03 (HanXRQChr14g0438141)
Entry ID 13748
Creation 2016-05-24 (Christophe Dunand)
Last sequence changes 2016-05-24 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaCSD03 (HanXRQChr14g0438141)
Name (synonym) HaCSD03 (HanXRQChr14g0438141)
Class Cu/Zn SOD    [Orthogroup: CSD002]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaCSD03
start..stop
S start..stop
LeCSD02 252 8e-88 1..157 1..156
ThasCSD03 238 3e-82 2..157 7..161
AtCSD03 230 5e-79 2..156 6..159
AtrCSD01 227 7e-78 4..157 6..158
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 86763291..86763375 85 N° 2 86763623..86763724 102 N° 3 86763857..86763952 96 N° 4 86764589..86764620 32
N° 5 86764811..86764886 76 N° 6 86765046..86765099 54 N° 7 86765374..86765399 26  
join(86763291..86763375,86763623..86763724,86763857..86763952,86764589..86764620 ,86764811..86764886,86765046..86765099,86765374..86765399)


exon

Literature and cross-references HaCSD03 (HanXRQChr14g0438141)
DNA ref. HanXRQ genome:   HanXRQChr14 (86763291..86765399)
Protein sequence: HaCSD03 (HanXRQChr14g0438141)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   157
PWM (Da):   %s   15977.02  
PI (pH):   %s   7.02
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGGLKAVAVITGSDNSVKGSLHFLQESNGVTQVRGKISGLKPGPHGFHIHALGDTTNGCNSTGPHFNPLNKEHGAPWDDTRHAGDLGNVIAGQDGVAEVSIDDKIPLSGQYSILGRAVVVHADPDDLGRGNHQLSKTTGNAGARIGCGVIGLQSS

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGGTTTGAAAGCGGTTGCAGTCATCACCGGCAGCGACAACTCCGTCAAAGGATCTCTTCACTTTCTTCAGGAATCCAATGGTCTCTCTCTCTCTCTCTTTTCACTATGTGTGTGT
GTTTTGTTCTTAAAACACCCAATTGCATCTTTAATTAATTAACAACAAAATCTCATGTGAATTCTTTCTCACTAGTTAAGTTTCTCTAATTCCATATGTTTTTTTTTTCTTTCTAGAGAT
TGCTATTATTAACCTAATATAGTTCATGTATACGGCCTGTATGGTCAGAACCCACTCAAAATTAGTTGATAAATTTAGTGGTTTGAAAACAGGGGTAACTCAAGTGAGAGGTAAGATCTC
AGGGCTTAAACCAGGTCCTCATGGCTTCCATATTCATGCTCTTGGTGATACCACCAATGGCTGCAATTCAACTG
GTACTTTTTCTTCACAAACTTTTATTTTCACTTATCAATTATGTAA
CTTTTAAGTCAAAATGTTTAATATATTCATTTACGGATGTGATTGGTTACTTGTTCATTCATACATACTTTTGATCCAAAATTTAGGACCTCATTTCAATCCGTTGAACAAAGAACACGG
AGCTCCTTGGGATGATACACGCCACGCGGGTGATTTGGGCAACGTTATTGCCGGCCAAGATG
GTGTGTGCTTCATTGCCCTAAACTCTCGAATTAGTCTTGATTTGGTTAACGACCATTT
GACATTTTCTTTTGTTGGTTCCATTATTACGCCCCACTTGCTTGCGGTGTGCACATAATATAAATATGTGTGGGCCCTCGGGGGGCAAAAGTGAAATTGTACTAATTTTAATGTTAATTT
ACTAATCTCGTGAAAATAACTTTAAAAGAGGCGGACGGTTAATTATGCATCATGTGGTGGCGTTGACAGCCGAAAGACAAAATGGTACATGCACTAACAGGCCTTTGTCCCGATTGTTGA
GTATTATGTGCCTTATGTCCAAGGCTTGATGCAAAACTACTATTGAGCCAGGGGTTCTCACTGGAAGCAGTCTCTCTATTCCTACGGGGTAGAGGTAAGGCTGTCTACATCTTACCCTCC
TCAGACCTTACCTTTGCTTTGCTATTGGTGGGATTTACTGAGCATGATGGTGATGATTTGTTGGTTCCATTATACATGAACACATAAAGAATTGATTACAGTCTCAATAAGGGATGGTGA
TTGGGAGCCATGAAATGCAAAGAATTGGCGTAGACGATTCGAGTGTCTACTGTTTATCTTTAGTATCATATAATATACAATCTTTATTCGTTTTGCAGGGGTTGCTGAGGTATCTATTGA
TGATAAAAAT
GTATGTATCTTATAACTCGCTTGTACCAAATATGTCCTACACGAAATCTTGATTTGGGAAGATAACGGAATTGTTTCTTTCACACATAATCGAAAACCTCAATGTTATTC
TGACAGAATCGCTCTTTTTTATTTTGGATTTAAAAGCTTTTCTTCTGTTGCATGACTGTATTCTCGGAAATATTTTCCAGATTCCACTAAGCGGGCAATATTCGATTTTGGGGAGGGCAG
TTGTTGTACATGCTGATCCTGATGATCTGGGGAGAG
GTAACGACTCATGCTTTATGCAAGATTTCATTTTTTTTTTTTTGTAAGTTTTGAAGTAATAGCTACCATATTGAAGCTATTTAA
GGTATTTTAGGAATTTGACTAATATCCGTTATTCATCAACTATCCATTAAATATGTTGCGACTTTCATGCTGCAGGTAATCATCAACTTAGCAAGACAACAGGAAATGCCGGTGCTAGAA
TTGGTTGTG
GTAATTTACTAATTTGCCCCCTTCTCTTTTCACTTATGCTAACAAAATATAAAGATGAACCTGGACAATTTCTAAAATCGTTCAGTTGAAAATACATATCGTGATCCGGGT
CACTTTATGTTCTCATCAGTAATCTTGGTTAAACCGATCCGAATCTCAGATAATCGTCTTCAAAGATGATTTAGATTTTAGATCAACTGCTTATCATTAAACGGTATATATGAATATTCT
TGAGAGGAACAGTGATGTTTTTTTTTGCAATGTTATCTAACAGGTGTTATTGGGCTTCAATCTTCAGTG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGGTTTGAAAGCGGTTGCAGTCATCACCGGCAGCGACAACTCCGTCAAAGGATCTCTTCACTTTCTTCAGGAATCCAATGGGGTAACTCAAGTGAGAGGTAAGATCTCAGGGCTT
AAACCAGGTCCTCATGGCTTCCATATTCATGCTCTTGGTGATACCACCAATGGCTGCAATTCAACTG
GACCTCATTTCAATCCGTTGAACAAAGAACACGGAGCTCCTTGGGATGATACA
CGCCACGCGGGTGATTTGGGCAACGTTATTGCCGGCCAAGATG
GGGTTGCTGAGGTATCTATTGATGATAAAAATATTCCACTAAGCGGGCAATATTCGATTTTGGGGAGGGCAGTTGTT
GTACATGCTGATCCTGATGATCTGGGGAGAG
GTAATCATCAACTTAGCAAGACAACAGGAAATGCCGGTGCTAGAATTGGTTGTGGTGTTATTGGGCTTCAATCTTCAGTG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCGGA TTCGGTGGAA GTGCAGAAAC GGTGAAGAAA GCAGATAACC GGAAAAATGG GTGGTTTGAA AGCGGTTGCA GTCATCACCG GCAGCGACAA CTCCGTCAAA GGATCTCTTC  ACTTTCTTCA GGAATCCAAT GGGGTAACTC AAGTGAGAGG TAAGATCTCA GGGCTTAAAC CAGGTCCTCA TGGCTTCCAT ATTCATGCTC TTGGTGATAC CACCAATGGC TGCAATTCAA  CTGGACCTCA TTTCAATCCG TTGAACAAAG AACACGGAGC TCCTTGGGAT GATACACGCC ACGCGGGTGA TTTGGGCAAC GTTATTGCCG GCCAAGATGG GGTTGCTGAG GTATCTATTG  ATGATAAAAA TATTCCACTA AGCGGGCAAT ATTCGATTTT GGGGAGGGCA GTTGTTGTAC ATGCTGATCC TGATGATCTG GGGAGAGGTA ATCATCAACT TAGCAAGACA ACAGGAAATG  CCGGTGCTAG AATTGGTTGT GGTGTTATTG GGCTTCAATC TTCAGTGTAA AGCTAGCAAT CAGGCTCATT TACGCTTTGT ATAACATGCA TTTACTTCTT AATCATGTTA TGAGGTCTAA  ATATTAACTA TAGAAGCATG TTTGGTATAT ACTTTCCTGG TATGTTTCTG TGAATTCAAA GTTATTTCGG TTGTATTAGT ATATAAACTT GAGATAATAA AACGTGTCAA CAATTAAACG  CTACTAGCGT AGTGGTGCCA CCATTAATCT CCGCCACCCA GTGGCAGATC CATGATTTTT AGTCAGCGGG GGACAAAAAC GGTCATGTTG GTATGGATCG GATACTTTGT ATTATTATTT  TTGTTTTTAC ATTAAATTGT AGAAAAAAAG TGACGTTGGA ATCGGGTAAA TTTAGCCTTT TAACCGTGGA CTTTTCTATA CTAGCATGGT TATACACGAG ACATTTGAAT CGGGTAAATT 
GACGTTGGAT ACTTGGATTT AG 

Retrieve as FASTA