Entry information : HaMSD01 (HanXRQChr14g0460121)
Entry ID 13749
Creation 2016-05-24 (Christophe Dunand)
Last sequence changes 2016-05-24 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaMSD01 (HanXRQChr14g0460121)
Name (synonym) HaMSD01 (HanXRQChr14g0460121)
Class Mn SOD    [Orthogroup: MSD001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaMSD01
start..stop
S start..stop
HaMSD02 432 1e-156 1..226 1..228
ThasMSD01 403 2e-145 1..226 14..233
AtMSD01 389 1e-139 1..224 1..229
AtSDL01 326 1e-114 20..223 30..233
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 168477405..168477684 280 N° 2 168478863..168478909 47 N° 3 168478986..168479111 126 N° 4 168479221..168479277 57
N° 5 168479392..168479469 78 N° 6 168480017..168480106 90  
join(168477405..168477684,168478863..168478909,168478986..168479111,168479221..1 68479277,168479392..168479469,168480017..168480106)


exon

Literature and cross-references HaMSD01 (HanXRQChr14g0460121)
DNA ref. HanXRQ genome:   HanXRQChr14 (168477405..168480106)
Protein sequence: HaMSD01 (HanXRQChr14g0460121)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   226
PWM (Da):   %s   25189.97  
PI (pH):   %s   8.69
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALRALTNVKTLGRLRHQQIRGLQTFTLPDLSYDYGALEPAISGEIMQLHHQKHHQTYITNYNKALEQLDDAIAKGDASTAVKLQSAIKFNGGGHVNHSIFWKNLAPTEGGGEPPHGSLGWAIDQHFGSMEKLVAKMNAEGAAVQGSGWVWLAVDKELKRLVVETTANQDPLVTKGASLVPLVGIDVWEHAYYLQYKNVRPDYLKNIWKVINWKYASEVYEKECP

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCACTTCGAGCTCTCACCAATGTCAAAACCCTAGGTCGGTTACGTCACCAACAGATTCGCGGACTGCAGACGTTTACGCTTCCTGATCTTTCCTACGATTATGGCGCACTGGAGCCG
GCGATTAGCGGCGAGATTATGCAGCTCCATCATCAAAAACACCACCAGACCTACATCACTAACTACAACAAAGCTCTCGAGCAGCTTGATGATGCCATCGCTAAAGGAGATGCATCTACC
GCCGTTAAATTGCAGAGCGCCATTAAGTTCAACGGCGGAG
GTTCGATTTTATAGTTTTTGTATTAATGTTTATCTAATTATGTTGTTTCGATACGTTTAGTTGTATATTTTGTTAGTAAT
TATAGTTGAATACATGCTAGAAGGACCTTTGTGTTGTTAAACTTGCAATATAATCGATATTAGTGGTAAGTAGATTTGACATCATGTGGTTTGAATCCATATGTGACTGCTATTGCTTAA
CAATTAAGTAATTAACTTTTATCATCAGGAATATTGACTTTGGGATGGTTAATTGACATGCATATTAGAAGATGTTATTACTTAAAAGTTTTGTGGTTTCAAAGAAGTTTATAGTGACGC
GATAATTATCCGTAGGAGATTCGGTTAGATTGGAGCAAGTGTGTGATCATGATGGTTTTGTGTGTGAATAAGTTGCGTTTGATTTTTGCAAGCTCTATAAATAGGTGTGATAAAGCTCAT
AGCGATACGTAGGGCTGGCAATTTTGACACGAACATGACACGAACCTACACGAAGTTAATAGGTTTCGTGTTTAACCTTAACAGGTTTCGTGTCTATAACAGGTCGACATGATAAGACCT
GTTTAATTTCGTGTCGTGTTCGTGTTTACCTAATTCGTGTTCGTGTCTTATCGTGTTCGTGTCTTAATAGGTCGTGTTTGTGTCTTAACAGGTCATGTCAGCCACGATATGACCTGTTAA
AATTTAAGACCATTATGCAGGTCGTGTTTATGTCTTAACATGTTGTGTTCGTGTCTTAACAGGTTGTATGATACGTTGGTAATTTTTTAGTGTATTAACAGGTCGTTTCGTGTAACATGT
TTATTATTAGGCTCGTGTTTGTGTTTATAAAATCTGGCACGATAAGATTTCGTGTCGTGTTCGTGTTTACCTGTTTTGGGTTCATGTCTTATCATGTTCAGGTCTTAACAGGTCGGGTTG
ACACGATATGCCAGCCCTACTCATATGAACATCTTGAGATTTATTGTTGCTGACACAGTGCCACTTCTTATAGTTTGTGTATTAAGTTAATGTAATGATGGTTGCAATAGTTATGCTATT
CACTGGTTGTTCAATCTCTTAACACGATAGATAGTTCAATACTTTTCTATTAGCTGGCTGTACTAGATTCTAACTAGTAACTAGAATTAAATTCATATACATACAGTATTCTTTTTTTAA
TTTTTTTTCTTATACCAGGTCATGTGAATCACTCAATTTTCTGGAAGAATCTTGCCCCTACTCGTGTAAGTCTGTTTTCTGATAATCCAATGATGATTCTGAGCATAACACTTGACTGAA
AGATGATGTCTTTTTATGCAGGAAGGGGGTGGTGAGCCGCCACATGGTTCGTTGGGGTGGGCCATTGACCAGCACTTTGGTTCTATGGAAAAATTGGTTGCCAAGATGAATGCCGAAGGT
GCTGCTGTTCAAGGCTCTGGATGGGTG
GTATGTTATACTGTCTCGTCTATAATTCGTATCATTCATCATTTTCAATTTTTATCGTTCATTCTGTTCTTGAACTCTGGTTTAATATACATG
TTTGCGATATTCTTAGTGGCTTGCAGTGGATAAGGAGCTGAAAAGGCTCGTAGTTGAAACAACTGCAAACCAGGTATGCATTGCTAGTTTTGTTCTTAGACTCTTTGCGGTTTGCACTAA
ATAAAGATTTCTCATGCATTTACAAGACGCTTAATATGTTAATAAATATCCATCGTGTCCGCTGCAGGACCCTCTGGTTACAAAAGGTGCAAGTTTGGTCCCACTAGTTGGCATAGATGT
CTGGGAGCATGCATACTACTTACAG
GTAATCACATAAGCTTTTATTTAGAGTAAATTACAAAAATTGTCCTTTATGTATATCACTTATTGCAAATTGTGTCCTTTGTCTTCAATAATTAC
AGAAAACGTACTCGATGTTTGCAAACTCTTGCAAGTTATGTCCTTTAGCCCTAACTCAGTTAATTTTTGTTGTTAAATCTGACCAAATGGACCCCACATGACGATATTATTTATGGTTAA
ATCTGACCAAATGGACCCCACGTGAGAGTAAAATGACCAAAATACCCTCATGTGGGGTCCATTTGGTCAAATTTAACCACAAAAATTAACTGAGTTAGGGCCAAAGAACATAACTTGCAA
GGGTTTGTAAACATCGAGTACGTTTTCTGTAATTATTGAAGACAAAGGACACAGTTTGCAATAAGTGACATACATAAATGACGATTTTTGTAATTTACTCCTTTTATTTATGCCGGTAGC
AGGTTTATGATCCACACAAACAGAAAGTTTTAAAACCCAAATTAATGATCGTCGTATTTACGTTTGATTGTTTTTTCTACACGTGAATACAGTACAAGAATGTTAGACCGGATTATCTGA
AGAACATTTGGAAAGTGATCAACTGGAAGTATGCAAGTGAAGTGTATGAGAAAGAATGTCCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCACTTCGAGCTCTCACCAATGTCAAAACCCTAGGTCGGTTACGTCACCAACAGATTCGCGGACTGCAGACGTTTACGCTTCCTGATCTTTCCTACGATTATGGCGCACTGGAGCCG
GCGATTAGCGGCGAGATTATGCAGCTCCATCATCAAAAACACCACCAGACCTACATCACTAACTACAACAAAGCTCTCGAGCAGCTTGATGATGCCATCGCTAAAGGAGATGCATCTACC
GCCGTTAAATTGCAGAGCGCCATTAAGTTCAACGGCGGAG
GTCATGTGAATCACTCAATTTTCTGGAAGAATCTTGCCCCTACTCGTGAAGGGGGTGGTGAGCCGCCACATGGTTCGTTG
GGGTGGGCCATTGACCAGCACTTTGGTTCTATGGAAAAATTGGTTGCCAAGATGAATGCCGAAGGTGCTGCTGTTCAAGGCTCTGGATGGGTG
TGGCTTGCAGTGGATAAGGAGCTGAAA
AGGCTCGTAGTTGAAACAACTGCAAACCAG
GACCCTCTGGTTACAAAAGGTGCAAGTTTGGTCCCACTAGTTGGCATAGATGTCTGGGAGCATGCATACTACTTACAGTACAAGAATGTT
AGACCGGATTATCTGAAGAACATTTGGAAAGTGATCAACTGGAAGTATGCAAGTGAAGTGTATGAGAAAGAATGTCCT

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGGAAGTAAG AAAAATAGTG TGCCTGTTTT GTGATAAAGC ACACAGGTAA GGATACATTT ACCTGGTTCT AAAACGCACA CAGATCCCAT TTGGCTTACT TATCTCTCCA TTTTTGTCTG  TCAATTGATT CGCACAACAA CAAATGGCAC TTCGAGCTCT CACCAATGTC AAAACCCTAG GTCGGTTACG TCACCAACAG ATTCGCGGAC TGCAGACGTT TACGCTTCCT GATCTTTCCT  ACGATTATGG CGCACTGGAG CCGGCGATTA GCGGCGAGAT TATGCAGCTC CATCATCAAA AACACCACCA GACCTACATC ACTAACTACA ACAAAGCTCT CGAGCAGCTT GATGATGCCA  TCGCTAAAGG AGATGCATCT ACCGCCGTTA AATTGCAGAG CGCCATTAAG TTCAACGGCG GAGGTCATGT GAATCACTCA ATTTTCTGGA AGAATCTTGC CCCTACTCGT GAAGGGGGTG  GTGAGCCGCC ACATGGTTCG TTGGGGTGGG CCATTGACCA GCACTTTGGT TCTATGGAAA AATTGGTTGC CAAGATGAAT GCCGAAGGTG CTGCTGTTCA AGGCTCTGGA TGGGTGTGGC  TTGCAGTGGA TAAGGAGCTG AAAAGGCTCG TAGTTGAAAC AACTGCAAAC CAGGACCCTC TGGTTACAAA AGGTGCAAGT TTGGTCCCAC TAGTTGGCAT AGATGTCTGG GAGCATGCAT  ACTACTTACA GTACAAGAAT GTTAGACCGG ATTATCTGAA GAACATTTGG AAAGTGATCA ACTGGAAGTA TGCAAGTGAA GTGTATGAGA AAGAATGTCC TTAAAACGAC GGATATTGAC  ATGACACCTA CCCGCAACAT TCGGTGTTAT GGCTCTTCAA AAGTTTGGAC ATGATGTAAT AAGGAAAGCC CCATTTTGCC CTGGGGATTA ACCCTTGTGT ATGCAAAACA TGAATAAGCT  TACATGTCAT TTTGCTTTTC GGTTATTCAC CGTTTGTAAT CGCAACTTCC TCTTTTGCTG CCTAACTATT TGTGTTGATA CTTGATATTT GATCGCGAGA TTTTTGTCGC TTAATCCTTT  CTTTTTAGCA CTATAGTTAT GCAGAAAGTA TTTAAGGTTG TATGGTTGCT CAGAACAAAC ACCTGGAGAA TAGGATGTCT CTATGTGCTA CGACTATGAC TGTTCAAATA GCACGTGGCT 
CGAAACACGC TCAAAACCG 

Retrieve as FASTA