Entry information : HaFSD04 (HanXRQChr17g0541091)
Entry ID 13750
Creation 2016-05-24 (Christophe Dunand)
Last sequence changes 2016-05-24 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaFSD04 (HanXRQChr17g0541091)
Name (synonym) HaFSD04 (HanXRQChr17g0541091)
Class FeSOD    [Orthogroup: FSD001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaFSD04
start..stop
S start..stop
ThasFSD03 373 1e-131 58..292 30..264
AtFSD03 367 2e-129 75..292 46..263
CbraFSD01 244 2e-80 62..286 48..295
PpaFSD02 240 1e-79 42..290 6..250
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 25466245..25466328 84 N° 2 25464571..25464660 90 N° 3 25464385..25464474 90 N° 4 25464064..25464255 192
N° 5 25462338..25462509 172 N° 6 25462023..25462096 74 N° 7 25461904..25461930 27 N° 8 25461022..25461045 24
N° 9 25460772..25460894 123  
complement(join(25460772..25460894,25461022..25461045,25461904..25461930,2546202 3..25462096,25462338..25462509,25464064..25464255,25464385..25464474,25464571..2 5464660,25466245..25466328))


exon

Literature and cross-references HaFSD04 (HanXRQChr17g0541091)
DNA ref. HanXRQ genome:   HanXRQChr17 (25466328..25460772)
Protein sequence: HaFSD04 (HanXRQChr17g0541091)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   292
PWM (Da):   %s   33519.79  
PI (pH):   %s   7.97
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSWSSSNYLCLSSSSSVTQFSRCKLPCESEGQRGKCQDLNRATNISAYNSLKPPSFKLDKGQRRNDHVLKKPRNISAYYSLKPPPYKFDALEPYMSKRTLEVHWGEHHRGYVESLNKYLGKDDILYGYTLDELIRVTYNNGNPLPEYNVAAQVWNHDFFWESMQPGGGNLPILGLLEQIEKDFGSFSNFREEFIETALTLFGSGWVWLVLKRNEKRLAIATTTNAVTPLVWDDPLLSLDMWEHSYYLDYKNDKARYVNVFMDHLVSWNAALARMARAQSFVNLGEPKIPVA

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTTGGTCCAGTAGTAACTATCTTTGCTTGTCAAGCTCAAGCTCTGTTACACAGTTTAGCAGGTGCAAGTTGCCTTGTGAGGTGAGGTTTTAGTGTTCATGGAATTGCTTGTTTGTT
ATTTGAATGTTCCTTATCTCTTGAAGTTGTTGTAGAAGTATGTCTTTAATCCAATTTGGAATCATTTTCTAAAGGACTGAAGTTTTCCTTTGTGTTTGATGTTACTGAATGAGGAACTAA
GCAGTTAATGCGGTAAAAAAACTGATATCGGTCAAGGACCGATATTTGAGATATCGGTTCTCGCGGTGGGATATCAGTAATTTTAATATCATGCTGAGTTTATTTTATATATATATATAT
ATATAGCAATTTGACACTAACAGTTCAGTATATTTTCTTACCATTAAGAAATTAACCTTTTGCAACTTGCAAAACACTACAACTGTAGTAAGTAGGAACTGATTAAGACTTAAAACACTA
ACATTTAACACTAACAATTAGCAATTAAGACTTAAAATTCCAATAGGGGTTAATAAGAAGAAAGACGAATGACTAAAAAGAAAGGTACTGATCTCGGGAAAATCGATGATATATCGGTCA
ATATCGCTGATAAGATCGGTACCGATATTCTGACCGATATTTTGCACCGATATCTCACCAAAGGACCGATAACCAATATATCACCGATATATAGGTGATATATCGCGATATTAACTCATA
GATGAGGAATAAACTCATTTTGCAAGAAATAAACAAATTCTAGGAAGTGTTGAACATAGATATCTAGGTATTTGAGTTTCATATCAAGTTATTTCTCACAATCCCAATGCTTTTAGGTGG
TGTTTGGTAAGCTTATTGTAGCCTTTTAGAGAAGCTCCATCCTAAAACTTAAATGATATTAATAACTTTTATTATAATGCATTAAACGAGTTAGCTCCTTTAATAAGCTATAACCCAAAC
ACCCCCTTAATAAGATGGCATCTATTAGTGTGTTTCTTAACAGTGTTCATCTCCATCATGCAGTCATGATAGAGATTTGGCTAGTTTTTGGAAATGTACACTCCTGTATAGTTTCTGAAA
ATGCTTATTATACTGAATGTCTGAATTCAAGTTTCGTTTGAGCAATGTTTGAGGAGCAATATCATCTGTAGTTACTAATTAGGATCTTGGTTTTAAAAAGCGAGAGGCGCACAAAAGCGA
CGAGGTCTAAAAATGAGGCGCGAAGCGCAAAGCGCAAAAGCGGTGGGCTTTTTGTACCCGAGGCGCAAGAAGATTATATAAATTTTTATATATATCCCATAGGTTTTTAGCATCCCTTAT
CCAAAATATAGGTATAGCTAAGGTTTATATATGATTTGATCTACATGTACAAGCCAAAAAACCTATTGTCCAACACTTTCATGCATAAAAACAACATAAAAACACCCAAAATACATAAGG
AGCGCGCCTCAGACCTCAAAAAACCCAAAAAAAATGCGCTTTTCTTGCGCTTTTTGGAAAAAGTGCGCCTCAGGTACCCTGAGGCGCTGATACCTGCGCCTTAGTGCGCCTCGCGCCTAG
GCGCCCCTCAGGCACGCTTTTTAAAACCCAGATTAGGATGCCATTTTGGTTACCTGGTCATGTATACCGGTTATTGTAATAACATTTAATGATCGTTTGACATGGCAGTCTGAAGGGCAA
CGCGGGAAATGTCAAGATCTAAATAGGGCAACAAACATTTCTGCTTACAACAGCTTGAAACCTCCGTCTTTTAAACTC
GTAAGTTTATGTAATATCACCAAATACTTTGTTTAGTTATTC
TGATCAACTTTACTTAATGTATTCTATCAGTCTTATCGGTTTATGACATGTCAGGATAAGGGTCAAAGAAGGAACGATCACGTCTTGAAAAAGCCAAGAAACATTTCTGCTTACTACAGC
TTGAAACCTCCACCTTATAAATTT
GTAAGCCTCGTTACCATCTTCCTATTTGAGTACTGCCACATGCTGAATCAAGCGAATGGGAAAAAAACAAGTATTATCATTTTAGCTGTTGAACAG
ATATTGATTTTGTCTTCTGTTTTTTTTTTTCAGGATGCCCTAGAGCCGTATATGAGCAAAAGAACGCTTGAGGTCCACTGGGGAGAACATCACCGTGGTTATGTGGAAAGTTTGAACAAA
TATTTAGGAAAGGATGATATATTATACGGATACACATTGGATGAATTGATCAGAGTCACATATAACAACGGAAACCCTCTGCCAGAATATAACGTTGCTGCTCAG
GTTTGAACAATTCAT
TAGTTACCAGTCTTTGAAACCTAGAATTAGCATGAGATCATTGCAGAATGAGCCACTGGTTCATATTAGATGATAGTGATAAATATCAAGAAACCATTCCTGCTTTTAGTCTACCAAGAA
ATCAAGATTTGACGTGCATTTTAGTGGATTTCATAGTATAAGGGTGGAGTACTTTGTAAAAAATATAATAAGTTAATCTAACTTAAATATATATAATTAGTATCATAATATTGGTATCTT
AATTTTAAAAAGCGATAGGCGCACAAAAGCGACGAGGTCTAAAATTGAGGCGCGAAGCGTAAAGCGCAGAAGCGGTGGGCTTTTCGTACCCGAGGCGCAAGGTGTTTATATAATTTTTTT
ATATATCCCATACATATCCCGTAAGTTTTTAGCTTCTTTTAACCAAAATATGATATAAATAAGGCTTTTATATCATTTTATTTACATGTACAAGTCAAAAAACCCAAGGTACAACATTTT
TCTGCAGAAAAACGCCTCAGATACATGAGGCGCGCGCCTCAGGCCAAGAAGCCCCCCAAAAAACCCAAAAATCTGCGCCTTTTGGGCGCTTCTTGTAATTACACAAGGCGCTGAGCGAAA
AAGGACCAGAGCTGCGCCTTAGTGCGCTCGCCCTCAGGCGCGCTTTTTAAAACCAAGATTGGTATTTTCTTTATATTTATTCATAACACAAATACACAATTATTCATAACACAATCCGTT
AGAGTTTAATTATTAAAACATTAATAACCAAACCCAGTAAATCCCACAAATAGCAAAACTATCTATCTCTAAAATTATACTAAACAAAATTCATTGAGAAAAGAATTAGTGAATGGAAAA
GAGTATACCACTATCTTATACACTTGAGAGTATTATCTCATTAAAACTATGACAATAAGGCTGGAGGGTGTGGGATAAATCCCCTAGGGGCTTTATCACGCCACGTCAGCTCCACGTCAG
CCAGGGGGCTTTATCACGCCTTCTCTTAACTTGCAGGGTGTGGGATAAAGCCCCCCTATTAAACAAAATAAAAAAAAAAAAAAGATTTCATTGGTTGAAAAGAGGTGGGCCCCACCTGCA
CCCCCCCTCCTTCCGTTAACACAATGGCGAGAGACCCATGGCGCCCCCTGTTAATTTGCTCGGTATGGGCGGTGGCGCCCCGGGGGCGCTATAGGTGGTGAGGTGACAGGGGTGGCGCCC
TCCATAGCCTCCGGCCTAAGAGATCCCAACACAAAGGCTATTTGAAAAAATCTTAAATCAACTAGTCAAGATTTTGAAAAAAAAATTAGTGATAATTTGATTTATGTCGTTTAATTGCCT
ATTCTAAAATCATAGTTTTCGATTTTTTAATAGAATTAATAACCTTAAAATTGGTTCCACGTGAATCTATATATAACCTGAATTTAATAACTTTATTTTTATCTTATATGAAAAGGCCCA
ATTTAAGTTATGATTCCTTGTTCTTTAGAGATCAAAAAGATGTTTTTTTTTTCTTTTTTTTTTTTTAATAAAATTCATATCGATATTGTACGTTTTCAGGTCTGGAATCATGATTTCTTC
TGGGAATCCATGCAACCAGGAGGTGGTAATTTACCGATATTGGGTCTACTTGAGCAGATTGAAAAGGATTTTGGTTCCTTTTCAAATTTTAGAGAAGAGTTTATTGAAACCGCACTCACA
CTATTTGGCTCTGGATGGGTTTGGCTTGTTT
GTATGTCTCCTGTCACTTGCTTGATTCTTTCATCATATATTTTTTTTATAAAATCTAGGAAATATTATATCTTTTGATGAATTCCATAT
AGTTTTCAAAATCAGGAAAAATATGTTTATGTAATTGAGAAGAAATGTGATTTTGTTATTGTAATGGATTGTGCATATTCATATTATCTGATTTTTGTGTGGTGTGGCTCGGTTACATTT
GTTGATTTCTGTGTATTTTTTTTTTGTTTCAGTAAAGCGGAATGAAAAACGACTTGCAATAGCTACAACGACAAATGCTGTAACCCCACTCGTTTGGGATGATATTGTAAGCAAGCTTCT
CGTATTGTTACTATTCTTATTATGTGAATATCTTTTTTTTCCTTTTACCAATGCGTTATTCTCTTTCTGCTTTCACAGCCTCTTCTTAGTTTGGATATGTGGGAGGTATTACTCTCTCTC
TCTCTCTCTCGATGAAATTACTATTTTATTCAAATATCTAAAACGATCCTTAAATGATGGCAAAGGAGATTAACTGTATATATCAATATCAATTTCAAGAGTGTTCTAATTAGGTCACTC
ATAATTTTTTTTTTTGTTCTAATTGGGTCATTCAAGTTTCATTTGATGTTTCAATCCTAGATATTTTACCTAAATAGAAGGTCATCCATCCTACATGGCATTTATATAGGTTTTTTATTT
AAAAAAATTGTTGACATGGCACATAAATGCCAAATGGATTAGAAAAAAATGCGAAATAGGTTTAAAATATTTTTTTTAATTGTAGAAAAGTTAAAAAAATGCGAAAAAAATTAAAAAATG
TGAATTTTTTTTCAAAAAATCTAAAAAGTTATAAATGAAGATAAACAACTAACGATAAAATTTCAACGATTTGTAATATTTGATCCTTTTGGGTTTTGATTTTGTTTTGATTTATTATAT
TTCTTTTTTTATTCCATGTCATCATGTTTTTTTTTAAAAGTTAAATAAATGCCATGTAGGACTATGACCTTCTATTCAGGTAAAATCTCTAGCATTAGAACACCAAAATAAAGTAGACTG
ATCTAATTGGAACAATAAATTTTATCAGTGACCTAATTGGAACACTCCTAAAACTTCATTACTATTTTGTGGCATATTCCCTATTTTTTAACGAATCTAAACAAACAAGTATTCTTTCAT
TTCAGTTGTTTTGAAATATTGTAATTTACTTTGAGATGTCTTAGTTTCTGGCATTCTTTTTTGGGTGGACTGTGTGTATTGGATTGATTATTCATTCTCATTTTCCTTTATTTTGTTTTG
CAGCATTCTTATTATCTGGATTACAAGGTATTATTTATATCAAACGCTCTTCTATAGTTCTATTCGCAGCCAATTGCTTAATATCTGTTTTACACATCTAGTTTCGTATTTAACTTGACC
ATATTTTTCTGTTCTCTCTCTTTTTTTTCAACAGAACGACAAAGCGCGGTATGTTAATGTCTTCATGGATCATCTTGTGTCATGGAATGCGGCATTGGCTCGAATGGCACGTGCACAATC
CTTTGTAAATTTAGGAGAACCGAAGATTCCGGTTGCC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTTGGTCCAGTAGTAACTATCTTTGCTTGTCAAGCTCAAGCTCTGTTACACAGTTTAGCAGGTGCAAGTTGCCTTGTGAGTCTGAAGGGCAACGCGGGAAATGTCAAGATCTAAAT
AGGGCAACAAACATTTCTGCTTACAACAGCTTGAAACCTCCGTCTTTTAAACTC
GATAAGGGTCAAAGAAGGAACGATCACGTCTTGAAAAAGCCAAGAAACATTTCTGCTTACTACAGC
TTGAAACCTCCACCTTATAAATTT
GATGCCCTAGAGCCGTATATGAGCAAAAGAACGCTTGAGGTCCACTGGGGAGAACATCACCGTGGTTATGTGGAAAGTTTGAACAAATATTTAGGA
AAGGATGATATATTATACGGATACACATTGGATGAATTGATCAGAGTCACATATAACAACGGAAACCCTCTGCCAGAATATAACGTTGCTGCTCAG
GTCTGGAATCATGATTTCTTCTGG
GAATCCATGCAACCAGGAGGTGGTAATTTACCGATATTGGGTCTACTTGAGCAGATTGAAAAGGATTTTGGTTCCTTTTCAAATTTTAGAGAAGAGTTTATTGAAACCGCACTCACACTA
TTTGGCTCTGGATGGGTTTGGCTTGTTT
TAAAGCGGAATGAAAAACGACTTGCAATAGCTACAACGACAAATGCTGTAACCCCACTCGTTTGGGATGATATTCCTCTTCTTAGTTTGGAT
ATGTGGGAG
CATTCTTATTATCTGGATTACAAGAACGACAAAGCGCGGTATGTTAATGTCTTCATGGATCATCTTGTGTCATGGAATGCGGCATTGGCTCGAATGGCACGTGCACAATCC
TTTGTAAATTTAGGAGAACCGAAGATTCCGGTTGCC

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGTTTTCTTC CATTAAAACG ATGATTGTTG TGGGTCGGAT AAGATTCACC ATCGAACCGT GCCCTAACTC AAGAGAACCA CCATCTACTC GAAAGGTGAC CATAGTACGA GGAAAGCCAA  CATACCGATA AGGATCAAGA ACATCAACGT CTCTCAACCT TGTACTATCG ATACAGAGCA GAACAGAGAA ACCCCATTAA GGTGTCTTTT TTTGAGGTGC CAGAAAGGGG TGTTTAGTAG  ATATGAGTTG GTCCAGTAGT AACTATCTTT GCTTGTCAAG CTCAAGCTCT GTTACACAGT TTAGCAGGTG CAAGTTGCCT TGTGAGTCTG AAGGGCAACG CGGGAAATGT CAAGATCTAA  ATAGGGCAAC AAACATTTCT GCTTACAACA GCTTGAAACC TCCGTCTTTT AAACTCGATA AGGGTCAAAG AAGGAACGAT CACGTCTTGA AAAAGCCAAG AAACATTTCT GCTTACTACA  GCTTGAAACC TCCACCTTAT AAATTTGATG CCCTAGAGCC GTATATGAGC AAAAGAACGC TTGAGGTCCA CTGGGGAGAA CATCACCGTG GTTATGTGGA AAGTTTGAAC AAATATTTAG  GAAAGGATGA TATATTATAC GGATACACAT TGGATGAATT GATCAGAGTC ACATATAACA ACGGAAACCC TCTGCCAGAA TATAACGTTG CTGCTCAGGT CTGGAATCAT GATTTCTTCT  GGGAATCCAT GCAACCAGGA GGTGGTAATT TACCGATATT GGGTCTACTT GAGCAGATTG AAAAGGATTT TGGTTCCTTT TCAAATTTTA GAGAAGAGTT TATTGAAACC GCACTCACAC  TATTTGGCTC TGGATGGGTT TGGCTTGTTT TAAAGCGGAA TGAAAAACGA CTTGCAATAG CTACAACGAC AAATGCTGTA ACCCCACTCG TTTGGGATGA TATTCCTCTT CTTAGTTTGG  ATATGTGGGA GCATTCTTAT TATCTGGATT ACAAGAACGA CAAAGCGCGG TATGTTAATG TCTTCATGGA TCATCTTGTG TCATGGAATG CGGCATTGGC TCGAATGGCA CGTGCACAAT  CCTTTGTAAA TTTAGGAGAA CCGAAGATTC CGGTTGCCTA ATAATTATGT CTCTTGTTTA GATAGCAAGT TTTGCAGGTA GTAATGCAAC CATTATTTGG AAAAATGTAT GCTTAAGCAT  TTAACTTTTG TGGCTGTTGA AAATTTCAGT TGCTTTTGTA GTTCTGCAAA CTCTCCACTT CACTAATGAC CAGGGACTAG ATATCCGATC ATTCAAATCA ACAGAACAAA CACAATCACC  AAAAACATTT GATTTTACAA TCACATACCC TTCATTTTCA CTAATCCTTA CATAATCCAA AAGCATTGGG GATAATAACA AAGTCATTAT TATTTCTAAA GTCTGTTCCT TCTAAATAAC  TAGAATTGAT TCCCCGCGTT GCGGGGTCAG TTTTTTTAAT GTGACTTGAG CGTACTGAAT GTTTTTGCAA TTGCTTATCA ATCATAACGT AAATAACTTG AATTTATACC GGCTCGCATA 
TAAAAATAAA CACATAAAAC TCGAATGAGT CAA 

Retrieve as FASTA