Entry information : HaGOX[P]01
Entry ID 13760
Creation 2016-05-30 (Christophe Dunand)
Last sequence changes 2018-03-22 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaGOX[P]01
Name HaGOX[P]01
Class Glycolate Oxidase     [Orthogroup: GOX002]*
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaGOX[P]01
start..stop
S start..stop
HaGOX[P]02 309 6e-109 1..191 35..225
HaGOX07 309 4e-107 1..191 85..275
HaGOX06 283 1e-96 1..191 110..300
HaGOX05 274 6e-93 1..191 106..296
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 93880863..93880940 78 N° 2 93880577..93880705 129 N° 3 93880404..93880460 57 N° 4 93880254..93880316 63
N° 5 93880095..93880164 70 N° 6 93879898..93880013 116 N° 7 93879842..93879864 23 N° 8 93879766..93879805 40
complement(join(93879766..93879805,93879842..93879864,93879898..93880013,9388009 5..93880164,93880254..93880316,93880404..93880460,93880577..93880705,93880863..9 3880940))


exon

Literature and cross-references HaGOX[P]01
DNA ref. HanXRQ genome:   HanXRQChr03 (93880940..93879766)
Protein sequence: HaGOX[P]01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   191
PWM (Da):   %s   21159.11  
PI (pH):   %s   5.84
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GLSFMSTCTIEEVSSSSDVVRFFELYVYKRREMYALMVKRAETNGLKGIILIADNPKLGRREAGIKKNKMIAPQLKSFEGLVLTEVDDNVGSNLEASVSRNFDPSLSWKNIAWLKSITKMPIMVNCVLTREEAIKAMEVGVEGIILSNHGAHQLDYVPTTIAVIEEVLNLQGLLKFLFDGGISRGMDVFK

Retrieve as FASTA  
Remarks Pseudogene from genomic (5' and 3' end are missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGGTTATCTTTCATGTCTACATGCACAATAGAGGAGGTTTCTTCCAGTTCCGATGTTGTTCGATTCTTTGAGTTATATGTAAGCAATTTTTGTAACTATTCTTTTATTCTTTCCTTTGGG
TGACCATGAGAACCCGTTAAAGAAAACTAATGGCCCACACAAGTACTCCATTGTTGCATCAAGCAACTTTTTAATTTCAATGTGAAATATTATACCGTTTTGCATTTGTTTTTCGGTCTA
TAAGAGACGTGAAATGTATGCTCTGATGGTGAAAAGAGCTGAAACAAATGGATTGAAAGGTATTATTCTTATTGCTGACAATCCTAAACTTGGCCGTAGGGAAGCCGGCATAAAAAAAAA
CAAG
TGAAAATCATCTTAAAATCAGTGATCTTTCCCCCGTTTTTTTAGTTTTATTATATTTTTTTTCAAGAAATATATATAATATCCTTTATTATGCGACTCTGTAACATTTTACTCAGA

ATGATTGCGCCCCAGCTGAAGAGTTTTGAAGGTCTTGTGTTAACTGAAGTTGATGAT
GCAAGTGAAATAACCATAATTTGTTTGGTTTTCATGGAGTTCCTTATTATGCATTAATTATAA
CAATTAATTATATGTGTTTTGCAGAATGTGGGTTCAAATCTTGAAGCTTCTGTATCCAGGAACTTTGATCCTTCTTTATCTTGGAAGGTAACGATAGGAACCATAATTTCAATCTACGAG
GTTTGTAAATAATAGATTATTTCACTAGAAGCAATTACAGCTCATATGTTTTGCAGAACATTGCTTGGTTAAAGTCCATTACAAAAATGCCAATAATGGTCAATTGTGTACTCACCCGGG
AAGAAG
GTAAGACCCGTTTGACCCATTATCTGATCCACCCATTCCACCTATCGTGCTACCTCTAATTATGTCTACGTATCTTGGCCGCCATCAAAGCTATGGAAGTAGGAGTTGAAGGAA
TCATATTGTCTAACCATGGAGCTCACCAGTTAGATTATGTTCCTACCACCATTGCGGTTATCGAAGAGGTGCTTAATCTTATC
ATCACTTACCGAGTATATAAAACACGAAAGTAGCAAG
GTTTGCTGAAATTTCTGTT
TGCAAGTGGTAGGTGCAGTTTAAGGAAGAGTACCAGTGATGGAGGAATAAGTCGAGGAATGGATGTATTCAAAGCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGGTTATCTTTCATGTCTACATGCACAATAGAGGAGGTTTCTTCCAGTTCCGATGTTGTTCGATTCTTTGAGTTATATGTCTATAAGAGACGTGAAATGTATGCTCTGATGGTGAAAAGA
GCTGAAACAAATGGATTGAAAGGTATTATTCTTATTGCTGACAATCCTAAACTTGGCCGTAGGGAAGCCGGCATAAAAAAAAACAAG
ATGATTGCGCCCCAGCTGAAGAGTTTTGAAGGT
CTTGTGTTAACTGAAGTTGATGAT
AATGTGGGTTCAAATCTTGAAGCTTCTGTATCCAGGAACTTTGATCCTTCTTTATCTTGGAAGAACATTGCTTGGTTAAAGTCCATTACAAAAATG
CCAATAATGGTCAATTGTGTACTCACCCGGGAAGAAG
CCATCAAAGCTATGGAAGTAGGAGTTGAAGGAATCATATTGTCTAACCATGGAGCTCACCAGTTAGATTATGTTCCTACCACC
ATTGCGGTTATCGAAGAGGTGCTTAATCTTATC
CAAGGTTTGCTGAAATTTCTGTTTGATGGAGGAATAAGTCGAGGAATGGATGTATTCAAAGCT

Retrieve as FASTA