Entry information : HaGOX[P]02
Entry ID 13761
Creation 2016-05-30 (Christophe Dunand)
Last sequence changes 2018-03-22 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaGOX[P]02
Name HaGOX[P]02
Class Glycolate Oxidase     [Orthogroup: GOX002]*
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaGOX[P]02
start..stop
S start..stop
HaGOX07 338 4e-118 35..225 85..275
HaGOX[P]01 309 8e-109 35..225 1..191
HaGOX06 311 6e-107 35..225 110..300
HaGOX05 302 2e-103 35..225 106..296
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 10997893..10997985 93 N° 2 10997734..10997820 87 N° 3 10997449..10997574 126 N° 4 10997277..10997333 57
N° 5 10997128..10997190 63 N° 6 10996986..10997055 70 N° 7 10996804..10996905 102 N° 8 10996651..10996727 77
complement(join(10996651..10996727,10996804..10996905,10996986..10997055,1099712 8..10997190,10997277..10997333,10997449..10997574,10997734..10997820,10997893..1 0997985))


exon

Literature and cross-references HaGOX[P]02
DNA ref. HanXRQ genome:   HanXRQChr06 (10997985..10996651)
Protein sequence: HaGOX[P]02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   224
PWM (Da):   %s   24421.79  
PI (pH):   %s   9
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMVVSTTVEERKGFLLCVCFRRDLDSQSRLYFSQGLSFMSTCTIEEVSSSSDVVRFFELYVYKRREMYALMVKRAETNGFKGIILTADNPKFGRREAGIKNKNDCAPLKSFEGLVLTEVDDNVGSNLEASASRNFDPSLSWMNIAWLKSITKMPIMINCVLTREEAIKAMEVGVERIILSNHGARQLDYVPTTLAVLKEVVGAV*GRVPVLFDGGIRRGTNVFK

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGGTGGTGTCGACTACAGTAGAGGAGAGGAAAGGCTTTCTTTTATGTGTGTGTTTTAGGAGAGATCTTGACAGCCAAAGCAGACTGTATGTAATATCATAATGGTAAATTAATTGA
ATTGTTTCAACTTATTAGATTACTTTTAATATTACTTTTATTTAGTTTTCTCAGGGGTTATCTTTCATGTCTACATGCACAATAGAGGAGGTTTCTTCCAGTTCCGATGTTGTTCGATTC
TTTGAATTATAT
GTAAGCAATTTTTGTAACTCTATTCTTTTATTCTTTCCTTTGGGTGACCATGAGAACCCATTAAAGAAAACTAATGCCCCACACAAGTACTCCATTGTTGCATCAAGC
AACTTTTTAATTTCAATGTGAAATATTATACCGTTTTGCATTTGTTTTTAGGTCTACAAGAGACGTGAAATGTATGCTCTGATGGTGAAAAGAGCTGAAACAAATGGATTCAAAGGTATT
ATTCTTACTGCTGACAATCCTAAATTTGGCCGTAGGGAAGCCGGCATAAAAAACAAG
TGAAAATCATCCTAAAATCAGTGATCTTTCCCCCGTTTTTTTAGTTTTATTATATTATTTTCT
AGAAATATTTATAATATCCTTTATTATGCAACTCTGTAACATTTTTACTCAGAATGATTGCGCCCCACTGAAGAGTTTTGAAGGTCTTGTGTTAACTGAAGTTGATGATGCAAGTGAAAT
AACCATAATGTTGTTTGGTTTTTATGGAGTTCCTTATTATGCATTAATTATAACAATTAATTATGTGTTTTCCAGAATGTGGGTTCAAATCTTGAAGCTTCTGCATCCAGGAACTTTGAT
CCTTCTTTATCTTGGATG
GTAACGAAAGGAACCATAATTTCAATCTATGAGGTCTGTACTAGAAGCAATTACAACTCATATGTTTTGCAGAACATTGCTTGGTTAAAGTCCATTACAAAA
ATGCCAATAATGATCAATTGTGTACTCACCCGTGAAGAGG
GTAAGACACGTTTGACCATTATCCGATCCACCCATTCCACCTATCGTGCTACCTCTAATTATGTCTACGAATCTTGGCCG

CCATTAAAGCTATGGAAGTAGGAGTTGAAAGAATCATATTGTCTAACCATGGAGCTCGCCAGTTAGATTATGTTCCTACCACCCTTGCGGTTCTCAAAGAGG
TGCTTAATCTTATCATCA
CTTACCGAGTATATAAAACTCGAAAGTAGCAAGGTTTACTGAAATTTCTGTTTGCAAGTGGTAGGTGCAGTTTAAGGAAGAGTACCAGTTCTGTTTGATGGAGGAATAAGGCGAGGAACG
AATGTATTCAAAGCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGGTGGTGTCGACTACAGTAGAGGAGAGGAAAGGCTTTCTTTTATGTGTGTGTTTTAGGAGAGATCTTGACAGCCAAAGCAGACTGTATTTTTCTCAGGGGTTATCTTTCATGTCT
ACATGCACAATAGAGGAGGTTTCTTCCAGTTCCGATGTTGTTCGATTCTTTGAATTATAT
GTCTACAAGAGACGTGAAATGTATGCTCTGATGGTGAAAAGAGCTGAAACAAATGGATTC
AAAGGTATTATTCTTACTGCTGACAATCCTAAATTTGGCCGTAGGGAAGCCGGCATAAAAAACAAG
AATGATTGCGCCCCACTGAAGAGTTTTGAAGGTCTTGTGTTAACTGAAGTTGAT
GAT
AATGTGGGTTCAAATCTTGAAGCTTCTGCATCCAGGAACTTTGATCCTTCTTTATCTTGGATGAACATTGCTTGGTTAAAGTCCATTACAAAAATGCCAATAATGATCAATTGTGTA
CTCACCCGTGAAGAGG
CCATTAAAGCTATGGAAGTAGGAGTTGAAAGAATCATATTGTCTAACCATGGAGCTCGCCAGTTAGATTATGTTCCTACCACCCTTGCGGTTCTCAAAGAGGTG
GTAGGTGCAGTTTAAGGAAGAGTACCAGTTCTGTTTGATGGAGGAATAAGGCGAGGAACGAATGTATTCAAAGCT

Retrieve as FASTA