Entry information : HaGOX[P]04
Entry ID 13763
Creation 2016-05-30 (Christophe Dunand)
Last sequence changes 2018-03-22 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaGOX[P]04
Name HaGOX[P]04
Class Glycolate Oxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaGOX[P]04
start..stop
S start..stop
HaGOX[P]01 197 2e-66 1..108 1..108
HaGOX07 194 2e-63 1..108 85..192
HaGOX[P]02 184 1e-60 1..108 35..142
HaGOX06 177 2e-56 1..108 110..217
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 29545110..29545187 78 N° 2 29544826..29544950 125 N° 3 29544652..29544709 58 N° 4 29544486..29544569 84
complement(join(29544486..29544569,29544652..29544709,29544826..29544950,2954511 0..29545187))


exon

Literature and cross-references HaGOX[P]04
DNA ref. HanXRQ genome:   HanXRQChr10 (29545187..29544486)
Protein sequence: HaGOX[P]04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   108
PWM (Da):   %s   12115.17  
PI (pH):   %s   9.2
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GLSFMSTCTIEEVSFSCDVVRFFQLYVYKRREMYALMVKRAETNGFKGIILTADNPKLGRREADIKNKMIAPQLKNFEGLVLTKVDDNVGSNLEASASRNFNSSLSWKVTKGTI

Retrieve as FASTA  
Remarks
[Incomplte: stopcodon found in downstream ]
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGGTTATCTTTCATGTCTACATGCACAATAGAGGAGGTTTCTTTCAGTTGCGATGTTGTTCGATTTTTTCAATTATATGTAAGCAATTTTTATAACTCTATTCTTTTATTCTTTCCTTTG
GGTGACCATGAGAACCCGTTAAAGAAAACTAATGCCCCACACAAGTACTCCATTGTTGCATCAAGCAACTTTTTAATATCAATGTGAAATATTATATTGTTTTGCATTTGTTTTTAGGTC
TACAAGAGACGTGAAATGTATGCTCTGATGGTGAAAAGAGCTGAAACAAATGGATTCAAAGGTATTATTCTTACTGCTGACAATCCTAAACTTGGCCGTAGGGAAGCCGACATAAAAAAC
AA
GTAAAAATCATCCTAAAAACAATGATCTTTCCCCCATTTTTTCAGTTTTATTATATTTTTTTCTAGAAATATATATAATCTCCTTTATTATGCGACTTTGTAACATTTTTACTCAGAA
TGATTGCGCCCCAGCTGAAGAATTTTGAAGGTCTTGTGTTAACTAAAGTTGATGAT
GCAAGTGAAATAACCATAATTTTGTTTGGTTTTTATGGAGTTCCTTCATTAATTATAACAATTA
ATTATATGTCTTTTGCAGAATGTGGGTTCAAATCTTGAAGCTTCTGCATCCAGGAACTTTAATTCTTCTTTATCTTGGAAGGTAACGAAAGGAACCATATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGGTTATCTTTCATGTCTACATGCACAATAGAGGAGGTTTCTTTCAGTTGCGATGTTGTTCGATTTTTTCAATTATATGTCTACAAGAGACGTGAAATGTATGCTCTGATGGTGAAAAGA
GCTGAAACAAATGGATTCAAAGGTATTATTCTTACTGCTGACAATCCTAAACTTGGCCGTAGGGAAGCCGACATAAAAAACAA
AATGATTGCGCCCCAGCTGAAGAATTTTGAAGGTCTT
GTGTTAACTAAAGTTGATGAT
AATGTGGGTTCAAATCTTGAAGCTTCTGCATCCAGGAACTTTAATTCTTCTTTATCTTGGAAGGTAACGAAAGGAACCATATAA

Retrieve as FASTA