Entry information : HaGOX10 (HanXRQChr16g0525731)
Entry ID 13769
Creation 2016-05-30 (Christophe Dunand)
Last sequence changes 2016-05-30 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaGOX10 (HanXRQChr16g0525731)
Name (synonym) HaGOX10 (HanXRQChr16g0525731)
Class Glycolate Oxidase    [Orthogroup: GOX001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaGOX10
start..stop
S start..stop
HaGOX09 616 0 1..346 20..365
BstrGOX03 614 0 1..348 20..369
AtGOX04 614 0 1..348 20..367
ThasGOX11 614 0 1..348 20..367
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 157638396..157638475 80 N° 2 157638190..157638314 125 N° 3 157638057..157638103 47 N° 4 157637858..157637935 78
N° 5 157637616..157637740 125 N° 6 157637474..157637540 67 N° 7 157637320..157637382 63 N° 8 157637122..157637191 70
N° 9 157636912..157637012 101 N° 10 157636720..157636824 105 N° 11 157636468..157636653 186  
complement(join(157636468..157636653,157636720..157636824,157636912..157637012,1 57637122..157637191,157637320..157637382,157637474..157637540,157637616..1576377 40,157637858..157637935,157638057..157638103,157638190..157638314,157638396..157 638475))


exon

Literature and cross-references HaGOX10 (HanXRQChr16g0525731)
DNA ref. HanXRQ genome:   HanXRQChr16 (157638475..157636468)
Cluster/Prediction ref. HanXRQ:   HanXRQChr16g0525731
Protein sequence: HaGOX10 (HanXRQChr16g0525731)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   348
PWM (Da):   %s   38008.04  
PI (pH):   %s   9.55
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MIYDYYASGAEDEWTLKENRYAFSRILFRPRILVDVSKIDMTTTVLGFKISMPIMVAPTAMQKMAHPGEYATARASAAAGTITLSSWGTSSVEEVASTGPGVRFFQLYVYKDRNVVTQLVKRAEKAGFKAIVLTVDTPRLGRRESDIKNRFVLPPNLSLKNFDGLNLGKLDTDDSGLASYVAGQVDRSLSWKDVQWLKSITPLPILVKGVLTAEDARIAVQYGVAGIIVSNHGARQLDYVPATIMALEVVKATQNRVPVFLDGGIRRGTDVFKALALGASGVFIGRPVVFSLAVDGEAGVRKTLQMLHDELELTMALSGCRSLAEISRNHIVAPWDPPRVTPRL*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATCTATGATTATTACGCGTCGGGCGCAGAAGATGAGTGGACTCTTAAAGAGAATCGATATGCTTTTTCGAGAATCTTGTAATATGTTTCTTTGATTTAATGATTATAGGAGGGTTTT
TTGATATTCAATATGACATTAGTTAATTTTTTTTCCTATAGGTTTCGGCCGCGTATACTTGTTGATGTGAGCAAGATAGACATGACCACAACGGTTTTGGGCTTCAAGATTTCTATGCCG
ATCATGGTTGCACCTACTGCTATGCAGAAAATGGCTCACCCTGATG
GTAAAGATAAAGAGAATCGATATTCTTTTTATTATAGTCGATTAGACGATTCTTATATAACTTAAAACAAGATT
AATTTGGTACAGGAGAGTATGCAACTGCAAGAGCATCAGCAGCTGCTGGAACCATCATGGTTTAGTCCCTTACATTTATTTAATTATTTTCCACTGTTTTTCGCCTTCACGTCTTTCGTA
TATTGTTGTTTTCCACCTTTGAATTTCACTTCATTACATTATACGCCCTTTGTTTTCCAGACATTATCCTCGTGGGGTACCTCTAGTGTCGAGGAGGTTGCTTCAACTGGTCCTGGTGTT
CGGTTTTTTCAGCTCTAT
GTGAGTCCCCTCCTATCTTATGAAACATTTTCCAAACATACATACACACAGATTATTTCATTTAACAGTTTCCAAATTTTAAATTAATGTTCCTTAAATATA
TCTGCAAATTGTTAGGTGTATAAAGACAGGAATGTGGTAACTCAGCTGGTGAAACGGGCCGAAAAGGCTGGTTTCAAGGCGATTGTCCTCACTGTTGATACCCCGAGACTTGGCCGAAGG
GAATCTGATATCAAAAACAG
GTATATACGCAATACTATTATCCAGTTATTATATATATATATACATGTTATATTCTTGAATGTGTCCATTTACAGATTTGTTCTGCCACCAAATCTTTCC
TTGAAGAACTTTGACGGGTTAAATCTCGGCAAGCTAGATAAG
GTTTAATACAATAAAACATTTACGGGTTTCGAGTTTTCTTCATTTCCATTATAAATTTATTATAACATCAATAACTGT
GATCAACTTGCAGACAGATGACTCTGGATTAGCTTCATATGTTGCAGGTCAAGTTGACAGGTCTCTTAGTTGGAAAGTGAGTTTTTTTTTTTTTTTTTTTTTTTTAATATTTTTATTTTT
TTTCATGTGTATTTATGTGAATTTTCACCAACTATATCAGATACAGTTATTGTTAAATTAATCATTTATTTATTTTTGGGACAGGATGTGCAGTGGCTCAAATCAATAACCCCGTTACCT
ATTCTAGTGAAGGGCGTTTTAACTGCCGAGGATG
GTAAATTATTCGAACGATTTTTTTTTTTTTAATTTATAGTTCTATAATTATACTAATTCTTATGGTTATTAATCTATCATTTTTTT
TTGTTTTCCAAAATTTAATTCAGCGAGGATCGCGGTGCAATATGGAGTAGCGGGAATTATTGTGTCAAACCATGGGGCTCGGCAACTTGATTATGTTCCTGCAACTATTATGGCTTTAGA
AGAG
GTCATATAATAGTGATAATAATATAGGTTTTCTTAAACATATATAATATCAATGATTTACAAAAAAAAAAGTGGTTATGTTTTACAGGTTGTTAAAGCTACTCAAAACAGGGTTCC
AGTATTTCTTGACGGAGGCATTCGGCGTGGGACGGATGTCTTCAAAGCATTGGCTCTTGGTGCATCTGGTGTATTT
GTAAGTAACTAACATGGTTATGCTCAAATAAAAGAATTTGACCA
TTTATATTATGATGGTTTTCAGATTGGTCGACCGGTGGTGTTTTCATTGGCGGTAGATGGTGAGGCTGGTGTCAGAAAGACTCTACAAATGTTGCATGATGAACTTGAGCTTACAATGGC
GTTAAGCGGGTGTCGTTCCCTGGCGGAGATATCCCGCAACCATATCGTGGCACCATGGGACCCGCCACGTGTCACTCCTAGGCTTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATCTATGATTATTACGCGTCGGGCGCAGAAGATGAGTGGACTCTTAAAGAGAATCGATATGCTTTTTCGAGAATCTTGTTTCGGCCGCGTATACTTGTTGATGTGAGCAAGATAGAC
ATGACCACAACGGTTTTGGGCTTCAAGATTTCTATGCCGATCATGGTTGCACCTACTGCTATGCAGAAAATGGCTCACCCTGATG
GAGAGTATGCAACTGCAAGAGCATCAGCAGCTGCT
GGAACCATCATG
ACATTATCCTCGTGGGGTACCTCTAGTGTCGAGGAGGTTGCTTCAACTGGTCCTGGTGTTCGGTTTTTTCAGCTCTATGTGTATAAAGACAGGAATGTGGTAACTCAG
CTGGTGAAACGGGCCGAAAAGGCTGGTTTCAAGGCGATTGTCCTCACTGTTGATACCCCGAGACTTGGCCGAAGGGAATCTGATATCAAAAACAG
ATTTGTTCTGCCACCAAATCTTTCC
TTGAAGAACTTTGACGGGTTAAATCTCGGCAAGCTAGATAAG
ACAGATGACTCTGGATTAGCTTCATATGTTGCAGGTCAAGTTGACAGGTCTCTTAGTTGGAAAGATGTGCAGTGGCTC
AAATCAATAACCCCGTTACCTATTCTAGTGAAGGGCGTTTTAACTGCCGAGGATG
CGAGGATCGCGGTGCAATATGGAGTAGCGGGAATTATTGTGTCAAACCATGGGGCTCGGCAACTT
GATTATGTTCCTGCAACTATTATGGCTTTAGAAGAG
GTTGTTAAAGCTACTCAAAACAGGGTTCCAGTATTTCTTGACGGAGGCATTCGGCGTGGGACGGATGTCTTCAAAGCATTGGCT
CTTGGTGCATCTGGTGTATTT
ATTGGTCGACCGGTGGTGTTTTCATTGGCGGTAGATGGTGAGGCTGGTGTCAGAAAGACTCTACAAATGTTGCATGATGAACTTGAGCTTACAATGGCG
TTAAGCGGGTGTCGTTCCCTGGCGGAGATATCCCGCAACCATATCGTGGCACCATGGGACCCGCCACGTGTCACTCCTAGGCTTTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAAGATTCAA TTATTTTGAC AATTATTAAA CCGATGATCA CGTGAGCCCT TACACCACCA CTTTGTTTGT ATTACTCCCG TGAAACTTCT TCTCACTACC CATTTCCGCC ACCTGCAATC  CATCACAGAC GACACTATTT TCACTAATCA CTACTCGATC AAGATGGAGA TTACCAATGT TATGGAGTAT GAGACACTTG CAAAGGAAAA GTTGCCCAAA ATGATCTATG ATTATTACGC  GTCGGGCGCA GAAGATGAGT GGACTCTTAA AGAGAATCGA TATGCTTTTT CGAGAATCTT GTTTCGGCCG CGTATACTTG TTGATGTGAG CAAGATAGAC ATGACCACAA CGGTTTTGGG  CTTCAAGATT TCTATGCCGA TCATGGTTGC ACCTACTGCT ATGCAGAAAA TGGCTCACCC TGATGGAGAG TATGCAACTG CAAGAGCATC AGCAGCTGCT GGAACCATCA TGACATTATC  CTCGTGGGGT ACCTCTAGTG TCGAGGAGGT TGCTTCAACT GGTCCTGGTG TTCGGTTTTT TCAGCTCTAT GTGTATAAAG ACAGGAATGT GGTAACTCAG CTGGTGAAAC GGGCCGAAAA  GGCTGGTTTC AAGGCGATTG TCCTCACTGT TGATACCCCG AGACTTGGCC GAAGGGAATC TGATATCAAA AACAGATTTG TTCTGCCACC AAATCTTTCC TTGAAGAACT TTGACGGGTT  AAATCTCGGC AAGCTAGATA AGACAGATGA CTCTGGATTA GCTTCATATG TTGCAGGTCA AGTTGACAGG TCTCTTAGTT GGAAAGATGT GCAGTGGCTC AAATCAATAA CCCCGTTACC  TATTCTAGTG AAGGGCGTTT TAACTGCCGA GGATGCGAGG ATCGCGGTGC AATATGGAGT AGCGGGAATT ATTGTGTCAA ACCATGGGGC TCGGCAACTT GATTATGTTC CTGCAACTAT  TATGGCTTTA GAAGAGGTTG TTAAAGCTAC TCAAAACAGG GTTCCAGTAT TTCTTGACGG AGGCATTCGG CGTGGGACGG ATGTCTTCAA AGCATTGGCT CTTGGTGCAT CTGGTGTATT  TATTGGTCGA CCGGTGGTGT TTTCATTGGC GGTAGATGGT GAGGCTGGTG TCAGAAAGAC TCTACAAATG TTGCATGATG AACTTGAGCT TACAATGGCG TTAAGCGGGT GTCGTTCCCT  GGCGGAGATA TCCCGCAACC ATATCGTGGC ACCATGGGAC CCGCCACGTG TCACTCCTAG GCTTTAGAAT CATTTGAAAA ACATTCAAGT TTATGATAGG AAGGTTGTGC CCAAATGAAC  TGATTGTTGG GGAAAAAGAA CTTAGAATAA TTATTTGGAG GGTTTCTGGA TTTACATTAG TGTTCCTACC AAATCATAAT ATCAAATAAA TAGAACTTGA TTAAATTTGC TTGATGAATT  GGTCAATTTG AAAATCCTTT GGACTGAGTT GTGTGGTCAG TGACGGACCC AAGATTTTTT TCATGGGGGC GATGGGGGGA TTAACCAACT TCTATGGGTA GTGATCGGGA TTTTAGCGTA 
TAAATAA 

Retrieve as FASTA