Entry information : HaDiOx01 (HanXRQChr03g0087031)
Entry ID 13770
Creation 2016-06-01 (Christophe Dunand)
Last sequence changes 2016-06-01 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaDiOx01 (HanXRQChr03g0087031)
Name (synonym) HaDiOx01 (HanXRQChr03g0087031)
Class Alpha-dioxygenase    [Orthogroup: DiOx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaDiOx01
start..stop
S start..stop
PtDiOx02 1031 0 1..630 1..629
CsDiOx01 1022 0 1..630 1..630
CclDiOx01 1021 0 1..630 1..630
LeDiOx02 1015 0 11..630 11..629
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 148279422..148279514 93 N° 2 148280146..148280406 261 N° 3 148282123..148282272 150 N° 4 148282681..148282814 134
N° 5 148283329..148283542 214 N° 6 148283809..148283954 146 N° 7 148284904..148285134 231 N° 8 148285210..148285412 203
N° 9 148285900..148286143 244 N° 10 148286249..148286480 232  
join(148279422..148279514,148280146..148280406,148282123..148282272,148282681..1 48282814,148283329..148283542,148283809..148283954,148284904..148285134,14828521 0..148285412,148285900..148286143,148286249..148286480)


exon

Literature and cross-references HaDiOx01 (HanXRQChr03g0087031)
DNA ref. HanXRQ genome:   HanXRQChr03 (148279422..148286480)
Cluster/Prediction ref. HanXRQ:   HanXRQChr03g0087031
Protein sequence: HaDiOx01 (HanXRQChr03g0087031)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   635
PWM (Da):   %s   72694.97  
PI (pH):   %s   7.05
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTLSLLSLFSIHPQLQPLVAKLSLLDTIVFYIVHIVDKCGLWHRLPVLLGLAYLGLRRRLHQRYNLLHVGTNTGKQYDVQQYPHRTADGKCNHPTDHIVGSQGTFFGRNMPPSTSNFGLLEPHPSVVATKLLERRKFADCGKQFNMIACSWLQFMIHDWIDHMEDTQQVEIVAPAEVAEQCPLKSFKFYKSKHFPTGSLDTKTGFLNSRTPWWDGSVIYGNNEAGMGKVRAYSDGKLKIARDGLLEHDDKGIPISGDVRNCWAGFSLLQALFVKEHNAICDMLDHYPEFDDEKLYQHARLVTSAIIAKIHTIDWTVELLKTDTLLAAMRINWYGMLGKKVKDLFGNILGPELSGLVGLKKPQDHGVPYSLTEEFVSVYRMHTILPDKIILRDIDSIAPKHKSIPPIQEEVNMKDMIGKEGEKRLSNIGMEKMLVSMGHQPCGAVTLWNYPSWMRNLVAHDIDGEERKDQVDMASMIYRDRERKVPRYNEFRRNLLMTPISKWEDLTDDEEIIDALNEVYGDDVEKLDLLVGIHAEKKIKGFAICETAFFIFVLVASRRLEADRFFTTNYNAQTYTEKGLQWINKIESLKDILDRHFPEMSKTWMRCSSAFSVWDSDPNTPNYVPLYLRYGNSC

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGCTTTCACTCCTTTCCTTGTTCTCCATCCATCCCCAACTACAACCTCTTGTAGCCAAATTGTCTTTACTTGACACCATCGTCTTCTATGTGAGTTCTCTATATCTCTATTTCTGT
GCGTGTGTGCGTGTACACAGAGCCGGCCTAGAAGGGGTGCAGGGTGGGCGACGGCTCAAGGCCCAAACCATCCGGGGGGGGGGGCTGAAAATTTATTTTTTTTAAAATAAAGTTATGCTG
TAAAACTTAAAATATATAAGTATTGAATTGGAAAATGACATCATGAGGCGCATAGTCTGCTGGTTCTCATGTCACTTTATTAGCGTGTTTATTATCTATGCATTAAATGCAAATGACATT
AACTGACTAATTTTGTATTAAACTAAATCAAAATGAAAATCATAATTACTTTCAAATCTAGTTTAAAAATAATTATTTATGTTAATTTCTTAAAATATTATTCAATACAATTAATTTTGT
GTTTCATTTTTTTATGAAAAGAGTCTTTTTTTTTTTTTTTTCCTTTCAACTCTATGTATTTTCAAAATAAATTTGTGTATTTTCTAAAAGTTTTAATTTTAGAGCCTTTTTATCTTCGGG
CCCATATATTTTGAAAGATTTTCAGAGAGAGGGCCTACATGTAAACAACAGTTACTGCAAAGAAGATATACGTGAAATAAACAATAGTAATGATTGGATTGGATTGGATTGGATTGTGGT
GCAGATTGTGCATATTGTGGACAAGTGTGGGTTATGGCATAGGCTACCAGTGCTACTGGGGCTGGCTTATTTGGGTCTCAGAAGACGCTTGCACCAGAGATACAATCTCCTACATGTAGG
AACAAACACCGGAAAACAATACGACGTGCAACAGTATCCTCATCGGACGGCTGACGGAAAGTGCAACCATCCAACGGATCATATCGTAGGCAGTCAAGGAACCTTTTTTGGTCGTAATAT
GCCTCCATCCACTTCCAACTTCGGG
GTAAGATTCCGAATTCATCAAGATTGTAATATAAACGAATTTTTTTTTATTTTTTTTTGGTTTATTATACACACACAGATGTGTATGCAATAGAT
ATATGGGAAGGATTAACAAATTTATATATGTATATACAAATAAATAAGGGGGTGTTTGGTGTTGCGTTTTCAAAATAGATTATGCGTTTTCAAAATAGATTTTGCATTTTCAAAACTGCG
TTTTGAAAAAACATGTAGGTACATGCTTCTCTAAAACTGCGTTTTGGAGGCAGATAATCACTTTTTCATCCAAATACTTTTTTAGATTATTTATGTTTTATAAACACAATAATCAAATAA
TCACTTCAAAACGTAATCCCAAACACCAAATAAAATGTGTTTTTTATAAAAAAAAATGTAATTTTATAATTCAAAATCGAATCATCAAAGCGGTTGTCTTCAAAATTCCTAGATCCGATA
TTAATTCAAAAATTGAGTTCAAAATTCAGTGTGTATAAAAAGGTACCATTTAAATATCTAAAACCCGAATTTCGGTTTAGATAATCAACAACCTGACTAATGGCGTGGTGGTTCATTTGT
AAAGGCTAAGCTTTTAAACACCTTAGGAGGGGAGGTCTTGGGTTTAAGTCTCACGACAAAAACAAAAGAAATTTGCCGTAAAAAAATCAACAATCTAGTGTATTACTATTATTAGAATCA
ACAACCTAGTGTATTGCTATTGTTAGAGAATGTTTGCAAAGAATAAATTTGTATGTGTGATTATTTTTGAGAAAATATAAATAGTATTTACATTAGACATGATGTTTCTGTTGGGTGGAT
GAAGGTCCGTGTTGGACTCCATTTTCCATTTCTTTCTAAAAAAACAAACTATTCGTAAACAATATGTTTTGATATTGACAAACAACATAAATTGTTAAAATCAATATATTTTTTTCTCTG
TTAACATTTTTTTTATATATTATTTTTAGTAAACAGATTATTTTATATATTGTTGTTTGTAGAAATATGAGGTCGTGGGTTTAAATGCCCACCTCCCTATCTGTCGGAAAAAAATTGTTT
ATGTCTCATTTTGTCAGTATCATAAATGAAATTATAACAATATTTGCTTAATTTGTTTTTATAGTTATTTTAACCACGAATTTTACTTGCTTAGGTTTAAATTAAGATCTTTCACCAAAG
CGTTTTTGCCTTTTAATTATCATTAATATTTGCTTAATTTGTTTTATATTTCTTTTAACCACGAATTTCACATTCTTAGGTTTAAACCTAGGTCTTTCACCAAAGAGATTTTGTCTCTTA
ATTATCATTGGCTATAACCGAAGTGGCAATATAGAAATTTTATCATCGTTATAAAATTAACCATCACCAACGACTGACCCGCCCTAATCACGGACAAAAGTTTTAAAATAATTAACTAAA
AGTACATTTTATAAATATATGTTGATTGGTCGTGCCAACGAATTAACAAAAAACCCAAATGTAAATAATTTATCAATATGTCGTTGATACGTTGGTTACAATTTTCATTAGCGACCTATC
ACCCACGCCATGTTTCCCAATATTCACCACTTTCACCGAGGGATTCTTCAATGATATCCGTTGCTGAAAGCCCTATGTTTTGTATTGTATTATGAATAAAAAAAAGTTGGAGTGTCTCAT
AATGAGAGAAATAATATGGTTTTGAAATTGAAGTTTTAACTTGTATCTTACAAATTTGAAGTTGTTGGAGCCTCATCCATCAGTGGTGGCCACAAAGTTACTTGAAAGAAGGAAATTTGC
AGACTGTGGGAAGCAATTCAACATGATAGCTTGCTCTTGGTTACAGTTCATGATTCATGACTGGATTGATCATATGGAGGATACTCAGCAG
GTCAAGGGAATTAACTTATTCAGTTGTAC
CATTATGGTCGACGAGAAAAAAATTAAAAATGTTTTTTTTTTTTTTTCTGAAAAGGAGTAATGACAAACGGGTGACTTTGTTGTTGGACCTTAAATTGGTTAGCCGCTAGGTAAGATATC
AACTTCGTATTCCTCAAATATCCAAAACTGACACGAGTGTACTTTGACAGCAAAAGTGGCGGTTAAAAAAAAAGATTCTGCAAAGTGAAGTTGTCAGATCAACTTTAAAGTCGCTATCTT
AGATAACGACTGACCTAGATTTGAAGCCTATCCAAAGAAACCACCCATTTGTCATTGGCTTTTTTTCAAAAGAACTCATTATTTATTAAATTAATTGTCAATCAAGGAACCTTGTGTTTG
TTAACGTTGGTCAATACAGGTTGAGATTGTAGCTCCGGCTGAGGTGGCTGAGCAGTGTCCATTGAAGTCATTTAAGTTTTACAAGAGCAAACACTTTCCTACAGGGTCACTTGATACTAA
GACTGGTTTTCTTAATTCAAGGACTCCATGGTG
GTAAGTTGCTTCAGTTATTCTAGGACATGTATTTTGACTTCACACAAGTCAAAATGACATTCTTCAATCTAGCATATCATATACTGA
GTTGGTAAAAAAAAAAAAGTTTAGCTAGTGAAGTAAGAAAGTAAAAAAAGTATAATGGGTATTTTCGCGACCGGACTGGTTGCGAGAACCAAGCATGTCTGGTTAAGGTTGAACCAGTTT
TTTAGTTTTGATTATTTTTCTCCTCAAATTTAGTTTACAGGTTATTTTATTTTTATTGTAGCGTATTTATATTTTATTGAAATTAGAATGTACATCTAAACATAGGTTAATTTTATCAAA
TTATTTATGATGTCATACGCTTCTTAATTTGGTTTAACTAGAGTACTGGTGGACTAGTAAAGCAACCGATTTGCTGCCTGGTCCGGCTATGAGGACATAATAATGAATTGGTTAAAAAAT
AAAATAAAAAATACGGTAGTTTATTGAAAAAGTTAGTTTGGTAACCACATTGCCGGATCTATTGCAGGGATGGAAGTGTTATTTACGGAAATAACGAAGCCGGGATGGGGAAGGTAAGAG
CGTATTCAGATGGAAAGCTGAAAATAGCTAGAGATGGACTTCTTGAACATGACGACAAAGGGATTCCTATATCTGGCGATGTCCGAAATTGTTGGGCTGGTTTCTCCCTTTTGCAAGCTT
TATTTGTTAAAGAGCATAATGCTATTTGTGATATGCTTAAA
GTAAGTTCATCACTTTTTCCTATCCATTTATCAACTATTTTTTATGGCAAAAACTTCAATAAAAATATAGAAAATACGG
GCCGGCAAGAAGCTGTAAAACCTACAAAATTACTAGATAATATTTATGCTCAAAAACAATATTTAAACAGCCAGAAACTAAAGTTTCCCTTGACACCCGAAATAGGTGTAAGTTTCATGT
AAGCAACAAGGTAGTCCATACAGCACAAACAATGGTTCAAGAACTTCATTTGTGACAATTTATGCAGGACCATTATCCAGAATTTGATGACGAGAAATTGTACCAACATGCAAGATTGGT
AACCTCAGCAATTATTGCAAAGATCCACACCATTGATTGGACTGTTGAACTCCTAAAGACTGATACTCTTTTAGCAGCTATGAGAATCAACTG
GTAAATAATTCACAAACTAGATTTTGC
TCGATTTTCAAATAAGAACTACATATGAACTTTCACTTGTATGTTTGCAAATAATAAACAAACAAACAAACCTAGCCAGTAAGGTCCCACATGTACGCGGTAGCGTAGGGTAGTGTCTGG
GAGGGTGAGAGACGGGGCAAATATGCACTTTATCTCAAAAGATAGAGAGATTGCACCCCAAATGAGACCACGATTATAACACTACTAGAAAACTGTTGTTTATTATGAATATTTTTTTAC
GATAAATTGGATTCCTACGCATTTCCTACTAATCGTTAAAATAAAAACGAATTCCGTTGGATTTCCGTCGAAAATTTCCGACACATTTCTTACGCATACCGATTCCTACAAATTTCCGAC
TAATAGTTAAAATGAAAACGAATTCCGTCGGAAATCCGTAGGAAATTTCTGACACTTTTCCTACGCATAACAATTTGTGGCTTTTTTGTCGTTTTTTTTGTCACAAAACTAAGACCCTTT
CTTGTTCTTCGGAATTTCGTGGGAAAAGTGTCTGCATTTTCATTCATAGGAAATGTGTAGGAAATTTTGGTAGGAATAGTGGCACTTTTCTAGTAGTGTAAAAACCCCTTTTTCTTTTTC
AAATGATATGTTTATGATATACAAACATGGAGTAACATGAATAGTTGCATCAAATTGTGTACAAGTGAAAAATTCTTGATACAAACATGGAGTAACTTGGAAGTAAAGTAAACACAAATC
CTTTTTTGTTAATCTAAAAAGGGATCACCGAATTAAGCTTTTTGATCCACTCCTATATGATGTTTGCGTAAGTTCACTATTAAGGTGAGCGGTTCAATTTCATCATCAAGTTTGAATTCA
GTATGGTGTGGTTTTGGACCTATAATTTTGACCCGACGCATGTGACGAAAATTACTGGATTTGTCACTGGAATTAAATGTAGGTATGGCATGCTTGGGAAGAAAGTGAAGGATTTGTTTG
GAAATATATTAGGACCCGAACTAAGCGGATTAGTTGGTCTAAAAAAGCCCCAAGATCATGGAGTGCCATATTCTTTGACGGAGGAGTTTGTAAGCGTCTACAGAATGCACACAATACTGC
CAGACAAAATAATTCTTCGTGACATCGATTCCATAGCTCCAAAACACAAATCCATTCCGCCAATTCAAGAAGA
GTATTGTTCTTTTTGTGTACACGTATTACATTATATGAAGAAATTGT
GAAATATAATGATCATTGTTTTGTATAGGGTGAATATGAAGGATATGATAGGAAAAGAAGGAGAAAAAAGATTGTCGAATATCGGTATGGAAAAGATGTTAGTATCCATGGGGCATCAAC
CTTGTGGTGCTGTCACTTTGTGGAACTATCCATCGTGGATGAGAAACCTTGTTGCTCATGATATAGATGGCGAAGAGAGAAAGGATCAGGTGGACATGGCTTCCATGGAAA
GTATGTACA
ACTTTTTGGAAACTTTACTTAATGGGGGGATGTTCTTCGATCTATGGTGTGTGTGTGTTTTTCAACTTAGATTTATAGTGTATTAGACCTTGGTAAAGGCGACTTCTTTTTCATCGAAAT
ATGGTTTTCTGCAAGAAAATGAAACCCCAAGTGAAGTAACACTTGGTAACCACAACTTCAAGTGAAAACATATTTGTCAACTGACTTTTATAAAAAAAATGGCACCACCCTAGTAATTGG
CATAAATGTTTTCATCTTATGTCAAGGTTGCCAAGGGAGATTTCCCATGGGGTTCCATTTTCTTGCGGAAAACCATATTCCGATGAAAAAGAAGTCGCTCTTCCCAAGTGCGACTACACT
ACAAATGAAGTTAAAAAGAAAACACACCAGGATTCTAACAACATTCTAAATTTTCATTATTATATTTAACTAGTTATATATGATCTTAGTGTAACATGCTTGTTGAAAAATTTAAAAGTT
TATAGAGATCGAGAAAGAAAGGTTCCTCGATATAACGAGTTTAGGAGGAACTTGCTAATGACCCCCATTAGCAAATGGGAAGATTTGACTGATGATGAAGAGATTATTGACGCGCTCAAT
GAAGTATACGGAGACGATGTTGAAAAGCTTGATCTGCTAGTGGGAATACATGCTGAGAAAAAAATTAAAGGTTTTGCCATTTGTGAGACTGCTTTTTTCATCTTTGTGCTAGTTGCTTCA
AG
GTAATATATACTTAATCCTAGTCTTGTTACCAGCTTGAACATATATGTGTAATTGGATGAGTATTATATTTTGTTAATCCAATGTTTAACCATGCTTGATTATAGGAGGCTTGAAGCA
GATCGCTTTTTTACAACCAACTATAACGCGCAAACATACACCGAGAAAGGACTACAATGGATTAATAAGATTGAGAGCCTGAAAGACATTCTTGATCGACATTTCCCTGAGATGTCAAAG
ACTTGGATGAGATGTTCTAGTGCGTTTTCGGTGTGGGATTCAGATCCAAATACTCCTAACTACGTTCCATTGTATTTGCGATATGGTAACTCATGTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGCTTTCACTCCTTTCCTTGTTCTCCATCCATCCCCAACTACAACCTCTTGTAGCCAAATTGTCTTTACTTGACACCATCGTCTTCTATATTGTGCATATTGTGGACAAGTGTGGG
TTATGGCATAGGCTACCAGTGCTACTGGGGCTGGCTTATTTGGGTCTCAGAAGACGCTTGCACCAGAGATACAATCTCCTACATGTAGGAACAAACACCGGAAAACAATACGACGTGCAA
CAGTATCCTCATCGGACGGCTGACGGAAAGTGCAACCATCCAACGGATCATATCGTAGGCAGTCAAGGAACCTTTTTTGGTCGTAATATGCCTCCATCCACTTCCAACTTCGGG
TTGTTG
GAGCCTCATCCATCAGTGGTGGCCACAAAGTTACTTGAAAGAAGGAAATTTGCAGACTGTGGGAAGCAATTCAACATGATAGCTTGCTCTTGGTTACAGTTCATGATTCATGACTGGATT
GATCATATGGAGGATACTCAGCAG
GTTGAGATTGTAGCTCCGGCTGAGGTGGCTGAGCAGTGTCCATTGAAGTCATTTAAGTTTTACAAGAGCAAACACTTTCCTACAGGGTCACTTGAT
ACTAAGACTGGTTTTCTTAATTCAAGGACTCCATGGTG
GGATGGAAGTGTTATTTACGGAAATAACGAAGCCGGGATGGGGAAGGTAAGAGCGTATTCAGATGGAAAGCTGAAAATAGCT
AGAGATGGACTTCTTGAACATGACGACAAAGGGATTCCTATATCTGGCGATGTCCGAAATTGTTGGGCTGGTTTCTCCCTTTTGCAAGCTTTATTTGTTAAAGAGCATAATGCTATTTGT
GATATGCTTAAA
GACCATTATCCAGAATTTGATGACGAGAAATTGTACCAACATGCAAGATTGGTAACCTCAGCAATTATTGCAAAGATCCACACCATTGATTGGACTGTTGAACTCCTA
AAGACTGATACTCTTTTAGCAGCTATGAGAATCAACTG
GTATGGCATGCTTGGGAAGAAAGTGAAGGATTTGTTTGGAAATATATTAGGACCCGAACTAAGCGGATTAGTTGGTCTAAAA
AAGCCCCAAGATCATGGAGTGCCATATTCTTTGACGGAGGAGTTTGTAAGCGTCTACAGAATGCACACAATACTGCCAGACAAAATAATTCTTCGTGACATCGATTCCATAGCTCCAAAA
CACAAATCCATTCCGCCAATTCAAGAAGA
GGTGAATATGAAGGATATGATAGGAAAAGAAGGAGAAAAAAGATTGTCGAATATCGGTATGGAAAAGATGTTAGTATCCATGGGGCATCAA
CCTTGTGGTGCTGTCACTTTGTGGAACTATCCATCGTGGATGAGAAACCTTGTTGCTCATGATATAGATGGCGAAGAGAGAAAGGATCAGGTGGACATGGCTTCCATGGAAA
TTTATAGA
GATCGAGAAAGAAAGGTTCCTCGATATAACGAGTTTAGGAGGAACTTGCTAATGACCCCCATTAGCAAATGGGAAGATTTGACTGATGATGAAGAGATTATTGACGCGCTCAATGAAGTA
TACGGAGACGATGTTGAAAAGCTTGATCTGCTAGTGGGAATACATGCTGAGAAAAAAATTAAAGGTTTTGCCATTTGTGAGACTGCTTTTTTCATCTTTGTGCTAGTTGCTTCAAG
GAGG
CTTGAAGCAGATCGCTTTTTTACAACCAACTATAACGCGCAAACATACACCGAGAAAGGACTACAATGGATTAATAAGATTGAGAGCCTGAAAGACATTCTTGATCGACATTTCCCTGAG
ATGTCAAAGACTTGGATGAGATGTTCTAGTGCGTTTTCGGTGTGGGATTCAGATCCAAATACTCCTAACTACGTTCCATTGTATTTGCGATATGGTAACTCATGTTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTAAATCC TAAAATACAT TCATTAATTA GTACCGAGAC ACATATGTTA TATATAGCAC GCACCCCAGT CCAACACAAC CCCACAATCC TCAAACATCC TCTACACCAT GACGCTTTCA  CTCCTTTCCT TGTTCTCCAT CCATCCCCAA CTACAACCTC TTGTAGCCAA ATTGTCTTTA CTTGACACCA TCGTCTTCTA TATTGTGCAT ATTGTGGACA AGTGTGGGTT ATGGCATAGG  CTACCAGTGC TACTGGGGCT GGCTTATTTG GGTCTCAGAA GACGCTTGCA CCAGAGATAC AATCTCCTAC ATGTAGGAAC AAACACCGGA AAACAATACG ACGTGCAACA GTATCCTCAT  CGGACGGCTG ACGGAAAGTG CAACCATCCA ACGGATCATA TCGTAGGCAG TCAAGGAACC TTTTTTGGTC GTAATATGCC TCCATCCACT TCCAACTTCG GGTTGTTGGA GCCTCATCCA  TCAGTGGTGG CCACAAAGTT ACTTGAAAGA AGGAAATTTG CAGACTGTGG GAAGCAATTC AACATGATAG CTTGCTCTTG GTTACAGTTC ATGATTCATG ACTGGATTGA TCATATGGAG  GATACTCAGC AGGTTGAGAT TGTAGCTCCG GCTGAGGTGG CTGAGCAGTG TCCATTGAAG TCATTTAAGT TTTACAAGAG CAAACACTTT CCTACAGGGT CACTTGATAC TAAGACTGGT  TTTCTTAATT CAAGGACTCC ATGGTGGGAT GGAAGTGTTA TTTACGGAAA TAACGAAGCC GGGATGGGGA AGGTAAGAGC GTATTCAGAT GGAAAGCTGA AAATAGCTAG AGATGGACTT  CTTGAACATG ACGACAAAGG GATTCCTATA TCTGGCGATG TCCGAAATTG TTGGGCTGGT TTCTCCCTTT TGCAAGCTTT ATTTGTTAAA GAGCATAATG CTATTTGTGA TATGCTTAAA  GACCATTATC CAGAATTTGA TGACGAGAAA TTGTACCAAC ATGCAAGATT GGTAACCTCA GCAATTATTG CAAAGATCCA CACCATTGAT TGGACTGTTG AACTCCTAAA GACTGATACT  CTTTTAGCAG CTATGAGAAT CAACTGGTAT GGCATGCTTG GGAAGAAAGT GAAGGATTTG TTTGGAAATA TATTAGGACC CGAACTAAGC GGATTAGTTG GTCTAAAAAA GCCCCAAGAT  CATGGAGTGC CATATTCTTT GACGGAGGAG TTTGTAAGCG TCTACAGAAT GCACACAATA CTGCCAGACA AAATAATTCT TCGTGACATC GATTCCATAG CTCCAAAACA CAAATCCATT  CCGCCAATTC AAGAAGAGGT GAATATGAAG GATATGATAG GAAAAGAAGG AGAAAAAAGA TTGTCGAATA TCGGTATGGA AAAGATGTTA GTATCCATGG GGCATCAACC TTGTGGTGCT  GTCACTTTGT GGAACTATCC ATCGTGGATG AGAAACCTTG TTGCTCATGA TATAGATGGC GAAGAGAGAA AGGATCAGGT GGACATGGCT TCCATGGAAA TTTATAGAGA TCGAGAAAGA  AAGGTTCCTC GATATAACGA GTTTAGGAGG AACTTGCTAA TGACCCCCAT TAGCAAATGG GAAGATTTGA CTGATGATGA AGAGATTATT GACGCGCTCA ATGAAGTATA CGGAGACGAT  GTTGAAAAGC TTGATCTGCT AGTGGGAATA CATGCTGAGA AAAAAATTAA AGGTTTTGCC ATTTGTGAGA CTGCTTTTTT CATCTTTGTG CTAGTTGCTT CAAGGAGGCT TGAAGCAGAT  CGCTTTTTTA CAACCAACTA TAACGCGCAA ACATACACCG AGAAAGGACT ACAATGGATT AATAAGATTG AGAGCCTGAA AGACATTCTT GATCGACATT TCCCTGAGAT GTCAAAGACT  TGGATGAGAT GTTCTAGTGC GTTTTCGGTG TGGGATTCAG ATCCAAATAC TCCTAACTAC GTTCCATTGT ATTTGCGATA TGGTAACTCA TGTTAGTAAT ATGGTGTATT TTGAGACAAA  AACCTTGGTT AGTATGATGA ATAAAACCTA TGTTTTATCC TTACTTCTTT AGGATCCGTA TGTTGTCTCA TGCGACGAAG AACATACCAA TTAATATAAA CTTCAACTTA TCACCTAGGC 
CCCATACCAC ATTAAGGTAA GGGTGCCACG TAAATTCGGT GTTGTTCATA TCATCTTAGA CTTCGGCATT TAAAGTATTA CTAGTTAAGG ATATAATTCT TTT 

Retrieve as FASTA