Entry information : HaDiOx06 (HanXRQChr14g0450071)
Entry ID 13775
Creation 2016-06-01 (Christophe Dunand)
Last sequence changes 2016-06-01 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaDiOx06 (HanXRQChr14g0450071)
Name (synonym) HaDiOx06 (HanXRQChr14g0450071)
Class Alpha-dioxygenase    [Orthogroup: DiOx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaDiOx06
start..stop
S start..stop
HaDiOx04 1285 0 1..643 1..643
HaDiOx05 1256 0 1..643 1..629
HaDiOx07 1128 0 1..643 1..626
HaDiOx02 1025 0 1..642 1..642
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 140594993..140595112 120 N° 2 140595201..140595467 267 N° 3 140597122..140597271 150 N° 4 140597369..140597502 134
N° 5 140597653..140597866 214 N° 6 140597952..140598097 146 N° 7 140598204..140598431 228 N° 8 140598547..140598749 203
N° 9 140598832..140599075 244 N° 10 140599179..140599404 226  
join(140594993..140595112,140595201..140595467,140597122..140597271,140597369..1 40597502,140597653..140597866,140597952..140598097,140598204..140598431,14059854 7..140598749,140598832..140599075,140599179..140599404)


exon

Literature and cross-references HaDiOx06 (HanXRQChr14g0450071)
DNA ref. HanXRQ genome:   HanXRQChr14 (140594993..140599404)
Cluster/Prediction ref. HanXRQ:   HanXRQChr14g0450071
Protein sequence: HaDiOx06 (HanXRQChr14g0450071)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   643
PWM (Da):   %s   73342.6  
PI (pH):   %s   6.67
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKTFMSFAKQQLLSPVKHFIHADFHELFERMTLIDKFLFLIIHGVDKSGIGWHRFPVFLGLTYLAIRRSLHDKYNLLNVGKTRVGVRFDTDDVDFRTANGKFNDPFNESAGSEGTFIGRNMPPVDQKEKLLKPDPMLVATKLLARKQLIDTGKQFNMIAASWIQFMIHDWIDHLEETNQIELRAPAEVASECPLKSFKFFETKEIDTGLSDIKKGHRNIRTPWWDGSVVYGSNSKAGRHVRTFIDGKLKIADDGLLQHDNDGLPIAGDVRNSWIGVSTLQALFIHEHNAVCDALKEYPYLDDEDLYRHARLVTSAVIAKVHTIDWTIELLKTDMLVAGMRANWYGLLGKRFKDTFGHVGGSILGGLVGLKKPENHGVPYSLTEEFTSVYRMHSLLPDQLVIRDVNSTPGPNKSPKITKEIDMINLIGKNGEKELSKIGFTTQMVSMGHQACGALELFNYPVWLRDIVPQNVDGTDRPDHIDLASLIYRDRERKVARYNEFRRSLFLIPISKWEDLTEDKEAIATLREVYGDDVEELDLLVGLMAEKKINGFAISETSFIIFLAMASRRLQADRFFTSDFNENVYTKKGFEWVNTTESLKDVLDRHYPEMSDRWMNSTSAFSVWDATPEPHNPVPIYFRLPK

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAACATTCATGTCTTTTGCAAAACAACAACTTCTTTCACCCGTCAAACACTTCATCCATGCCGACTTTCATGAACTCTTTGAAAGGATGACACTCATCGACAAGTTTCTCTTCTTG
GTACGTTAATGCTGCATGCATGTAATTAAACACTTAATTAAACTTTTAATTTACTATAGCTCATTCTAAGATTATAATACTTTGGCAGATCATTCATGGTGTCGATAAATCCGGGATAGG
ATGGCACCGTTTTCCTGTGTTCTTAGGTCTTACTTACTTGGCCATTCGCCGGAGTCTTCATGATAAGTATAATCTGCTCAATGTTGGGAAAACTCGGGTAGGGGTTCGGTTTGATACCGA
TGACGTTGATTTCAGGACCGCCAATGGAAAGTTTAACGATCCTTTCAATGAAAGTGCCGGCAGTGAAGGAACTTTCATTGGCCGTAACATGCCCCCCGTTGATCAGAAAGAGAAG
GTATA
TTAATCGATGAACTTCAAATTAACACATATTGACATATATATCACTAGCTAGTTATTTTTTACAACGTTGACTGGTTAATTAGGGTTTCTTTTAGGTTTTGATTGACAAAGAGCACAAGA
AAAATATTAGTATATCCTTTTACTATTTTATTTCAAGTTAGTCTTAATAGAGACATGATAGAAAAAGCAACCACGACGTCTTTGCTTTAATTTTCAAGCTTTTTAGACACGAACTTTTCC
CAAAGTTTTATTTGTAAGATGTTTAGGATGATATTTAAAAAGATTATACATGTTTTTTTTTTAAATCCTAGCACAAATCTATACATATATCCAGTGGCGGAACTAGAAAATCTTCATAGG
GGTAACGTCTTAAAAGAAAAGGGTAACGAAATCGAAAAAAGGTTAAAAAAATGTCAATTTTTTCCAAAATTTACACTACCGCCGGAGCGCCAAGGGGTAGCGGAGGCTACCCCTTCTCAT
ATGGTACATCCGCCCCTGCATATATCCTTAAATTTACGTAACATGTTTTGCAAAATAAATTAGTGATAGTTTGATAGTCATTTGGGTGATTTCCGTGTATTTATGTAAGCATTATTAGGT
CTACATGAGGGGAGTATATTAGAGATCATCAATTGTCTCAACCAAACTTAATATTTAGAGCTTTGTATATCTATATATTTTAGGCTTTTTTCATACTAATTAATCCAACTTCATAATTAG
AGGCTTAGAGCTTTGTATATCGATATTCTTACTAATTAATTCTAAATATAAATCTCAAGGTCAGATAAGCTTGACACACGTGATTATCTAAAATTTTAATAATCATCAAGAGAATTCTGT
CCATCTTTAAATTAGATGTTTATTACTCTTGTAGATAATACAAAAGTCATATATAAACATACCGATCGATTCACTGTCATTGTTCATGATTTGTTATTCTTTCTTTCGTGTTTTCATTTG
TAATGTAGTTATTGGCAGTACTAGATATTCTAACTGCCACTCCGATATATCCCATTAAAACATCACGTAAGGTCCACACCAACATTTATAAAATAAGATTAAAATTTTTTAGTCTAAATA
CTTTCCTTTTTATATAATATGTGACAATGACCTGACTTCCTTTCGTTAGATGGTAATAGCAATTTTATCCGACATAATTATCAATGAGATTAAAGTGAGATATGATATACACGAAACCCA
CTTTTTAACAAGAATTTTTTACACATAAATATCATCCAACTTTTCACTTACAAAGATTTAAATTCATTTTCTATGAGGAAAAAAAAACACCATCCTACTAGACCATTAGATCATGAGTAC
ATATCCAGTTTATTAATCACACGTTTGTCTAATCAGTAAAAATTAAACAAGCAGGTCTCGAAGATTTCATTCTTATTATACCTTATAAATTTTATAATCATTTTTATACAAGTGTCATCC
TTTGCTTGTGTTCTTGTCTAAAGCTGATATTACTATCAAATTTAAAGCAAGTAAATAACTTCTAGATAAAAATGCAACATGCAAAAAAGTTCGTTCATCTAATAGTAGTTATTCAATGCA
ACTCACAATAAACCTAAGAAATTTGAAATGGTAGTCGAGCTTTGAATGTAGGGTGAGACAATTGTACTAAAACGTATTTCTGTGTGCAGCTGTTGAAGCCGGATCCGATGTTGGTAGCAA
CAAAGCTTCTAGCACGTAAACAACTTATAGACACCGGAAAGCAGTTCAACATGATTGCTGCTTCATGGATTCAGTTCATGATTCATGATTGGATTGATCACCTTGAAGAAACAAATCAG
G
TTCGATTAATCAAGATATTATATAATCTCGTGACATAAGAAGGATGAACTTTTGTACTAACACATAATATGTTACCATGGATTATTATGATAACAGATTGAGCTTAGGGCGCCAGCAGAA
GTAGCAAGTGAATGCCCTCTCAAATCCTTCAAGTTCTTCGAGACTAAAGAAATCGATACTGGTCTTTCTGACATTAAGAAAGGTCATCGTAACATCAGAACTCCTTGGTG
GTATGATTTC
TATAATTTAATTAATCATATTTTATAACCTCGCATTGTTAAAAACTCTCAAAGTTATAATAAAAGAATTGAGAAAGACAATCATTGTATATACAAATAAATAGTACGAAGTTAAGAGTGG
GATATATATGATATGTACAGGGATGGGAGTGTGGTATATGGAAGCAACTCAAAGGCTGGACGTCACGTAAGAACGTTCATTGACGGAAAGCTCAAGATTGCAGATGATGGTCTCCTTCAA
CATGACAACGATGGATTGCCTATAGCGGGAGACGTTCGTAATAGTTGGATTGGGGTGTCAACTTTGCAAGCCCTCTTTATCCACGAGCACAATGCGGTTTGTGACGCCTTAAAG
GTATAT
GTGTATATGATAAACATGTAGCTAGTTATTTTTAGTTTATTAGCTAGCTAGTGGCTTACAATATACTTATGTCAATCAGAAAGAATATCCTTATTTGGACGATGAAGATCTGTATCGCCA
CGCAAGACTAGTAACTTCTGCGGTGATCGCAAAGGTGCACACCATTGATTGGACCATTGAGCTTCTCAAAACTGACATGCTTGTTGCTGGAATGAGAGCTAACTG
GTAATTACTTACTTT
AAAATAAATAATTAATCTAGTCTTATGTGTTAATTACATTCATGAAATGAAGCATATTTACTAATATTTTGTTGAAATATGATATATTAAGGTATGGGCTATTGGGGAAAAGATTCAAGG
ACACATTTGGGCATGTTGGAGGATCTATTTTGGGAGGACTAGTAGGGCTAAAGAAACCCGAAAACCACGGGGTACCCTACTCGCTAACAGAAGAGTTTACAAGTGTTTATCGAATGCATT
CTCTCTTACCTGATCAACTTGTCATAAGGGATGTTAATTCCACACCAGGACCTAACAAGTCTCCAAAGATTACCAAGGA
GTATGTAAATCGCACCTAAGTTATTTTCTCTTAATTTGAAT
AACAATTTACTTCTTTGTATCTTCATGTAATAACCAACAAATAAGTATGCTCATAGTTATTAATTTATATTCAGGATTGACATGATCAATTTGATTGGAAAGAATGGAGAAAAGGAATTA
TCAAAAATTGGATTTACCACACAAATGGTATCCATGGGACATCAAGCGTGTGGGGCGCTTGAGCTATTCAACTATCCAGTCTGGCTTAGGGACATTGTGCCTCAAAACGTGGACGGGACA
GATCGCCCTGACCACATTGACTTAGCATCACTCGACA
GTACGATACTATTTTCTTTCACCAAAGAATGTGTACATACATGATTTATTTTGATCCTAACATATGATCATGATGCGTGCAGT
TTATAGGGATAGGGAGAGGAAAGTAGCAAGATACAATGAGTTCCGTAGATCACTTTTCTTGATCCCAATTTCCAAATGGGAAGATCTAACGGAGGACAAAGAAGCTATTGCCACATTGCG
TGAAGTGTACGGTGATGATGTCGAAGAGCTTGATTTGTTAGTAGGATTGATGGCTGAGAAAAAGATCAATGGGTTCGCCATTAGCGAAACCTCTTTTATAATCTTTCTAGCCATGGCCTC
AAG
GTATATATACAAATCACTACGATAAAGAGAATGAAAACTGTAAATTAACAAACTAATGGATCAATTATATATACCAACTAAATATATTGGGTCATGTGTGCAGGCGACTCCAAGCGG
ATAGATTCTTCACTAGCGATTTCAACGAAAATGTGTACACGAAAAAAGGGTTCGAATGGGTAAACACAACAGAGAGTCTGAAAGATGTGTTGGACCGACACTATCCAGAGATGAGCGATA
GATGGATGAACTCAACGAGTGCTTTTTCGGTGTGGGATGCTACCCCAGAACCTCATAATCCCGTACCAATTTATTTTCGTCTCCCCAAGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAACATTCATGTCTTTTGCAAAACAACAACTTCTTTCACCCGTCAAACACTTCATCCATGCCGACTTTCATGAACTCTTTGAAAGGATGACACTCATCGACAAGTTTCTCTTCTTG
ATCATTCATGGTGTCGATAAATCCGGGATAGGATGGCACCGTTTTCCTGTGTTCTTAGGTCTTACTTACTTGGCCATTCGCCGGAGTCTTCATGATAAGTATAATCTGCTCAATGTTGGG
AAAACTCGGGTAGGGGTTCGGTTTGATACCGATGACGTTGATTTCAGGACCGCCAATGGAAAGTTTAACGATCCTTTCAATGAAAGTGCCGGCAGTGAAGGAACTTTCATTGGCCGTAAC
ATGCCCCCCGTTGATCAGAAAGAGAAG
CTGTTGAAGCCGGATCCGATGTTGGTAGCAACAAAGCTTCTAGCACGTAAACAACTTATAGACACCGGAAAGCAGTTCAACATGATTGCTGCT
TCATGGATTCAGTTCATGATTCATGATTGGATTGATCACCTTGAAGAAACAAATCAG
ATTGAGCTTAGGGCGCCAGCAGAAGTAGCAAGTGAATGCCCTCTCAAATCCTTCAAGTTCTTC
GAGACTAAAGAAATCGATACTGGTCTTTCTGACATTAAGAAAGGTCATCGTAACATCAGAACTCCTTGGTG
GGATGGGAGTGTGGTATATGGAAGCAACTCAAAGGCTGGACGTCACGTA
AGAACGTTCATTGACGGAAAGCTCAAGATTGCAGATGATGGTCTCCTTCAACATGACAACGATGGATTGCCTATAGCGGGAGACGTTCGTAATAGTTGGATTGGGGTGTCAACTTTGCAA
GCCCTCTTTATCCACGAGCACAATGCGGTTTGTGACGCCTTAAAG
AAAGAATATCCTTATTTGGACGATGAAGATCTGTATCGCCACGCAAGACTAGTAACTTCTGCGGTGATCGCAAAG
GTGCACACCATTGATTGGACCATTGAGCTTCTCAAAACTGACATGCTTGTTGCTGGAATGAGAGCTAACTG
GTATGGGCTATTGGGGAAAAGATTCAAGGACACATTTGGGCATGTTGGA
GGATCTATTTTGGGAGGACTAGTAGGGCTAAAGAAACCCGAAAACCACGGGGTACCCTACTCGCTAACAGAAGAGTTTACAAGTGTTTATCGAATGCATTCTCTCTTACCTGATCAACTT
GTCATAAGGGATGTTAATTCCACACCAGGACCTAACAAGTCTCCAAAGATTACCAAGGA
GATTGACATGATCAATTTGATTGGAAAGAATGGAGAAAAGGAATTATCAAAAATTGGATTT
ACCACACAAATGGTATCCATGGGACATCAAGCGTGTGGGGCGCTTGAGCTATTCAACTATCCAGTCTGGCTTAGGGACATTGTGCCTCAAAACGTGGACGGGACAGATCGCCCTGACCAC
ATTGACTTAGCATCACTCGACA
TTTATAGGGATAGGGAGAGGAAAGTAGCAAGATACAATGAGTTCCGTAGATCACTTTTCTTGATCCCAATTTCCAAATGGGAAGATCTAACGGAGGAC
AAAGAAGCTATTGCCACATTGCGTGAAGTGTACGGTGATGATGTCGAAGAGCTTGATTTGTTAGTAGGATTGATGGCTGAGAAAAAGATCAATGGGTTCGCCATTAGCGAAACCTCTTTT
ATAATCTTTCTAGCCATGGCCTCAAG
GCGACTCCAAGCGGATAGATTCTTCACTAGCGATTTCAACGAAAATGTGTACACGAAAAAAGGGTTCGAATGGGTAAACACAACAGAGAGTCTG
AAAGATGTGTTGGACCGACACTATCCAGAGATGAGCGATAGATGGATGAACTCAACGAGTGCTTTTTCGGTGTGGGATGCTACCCCAGAACCTCATAATCCCGTACCAATTTATTTTCGT
CTCCCCAAGTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GTTATATATA GGCCATCTTG GCATTGTAAA CCTCACAAAA ACATCTCACT TTGCCCATCA AACACTTCAT CAATACCCAA AATGAAAACA TTCATGTCTT TTGCAAAACA ACAACTTCTT  TCACCCGTCA AACACTTCAT CCATGCCGAC TTTCATGAAC TCTTTGAAAG GATGACACTC ATCGACAAGT TTCTCTTCTT GATCATTCAT GGTGTCGATA AATCCGGGAT AGGATGGCAC  CGTTTTCCTG TGTTCTTAGG TCTTACTTAC TTGGCCATTC GCCGGAGTCT TCATGATAAG TATAATCTGC TCAATGTTGG GAAAACTCGG GTAGGGGTTC GGTTTGATAC CGATGACGTT  GATTTCAGGA CCGCCAATGG AAAGTTTAAC GATCCTTTCA ATGAAAGTGC CGGCAGTGAA GGAACTTTCA TTGGCCGTAA CATGCCCCCC GTTGATCAGA AAGAGAAGCT GTTGAAGCCG  GATCCGATGT TGGTAGCAAC AAAGCTTCTA GCACGTAAAC AACTTATAGA CACCGGAAAG CAGTTCAACA TGATTGCTGC TTCATGGATT CAGTTCATGA TTCATGATTG GATTGATCAC  CTTGAAGAAA CAAATCAGAT TGAGCTTAGG GCGCCAGCAG AAGTAGCAAG TGAATGCCCT CTCAAATCCT TCAAGTTCTT CGAGACTAAA GAAATCGATA CTGGTCTTTC TGACATTAAG  AAAGGTCATC GTAACATCAG AACTCCTTGG TGGGATGGGA GTGTGGTATA TGGAAGCAAC TCAAAGGCTG GACGTCACGT AAGAACGTTC ATTGACGGAA AGCTCAAGAT TGCAGATGAT  GGTCTCCTTC AACATGACAA CGATGGATTG CCTATAGCGG GAGACGTTCG TAATAGTTGG ATTGGGGTGT CAACTTTGCA AGCCCTCTTT ATCCACGAGC ACAATGCGGT TTGTGACGCC  TTAAAGAAAG AATATCCTTA TTTGGACGAT GAAGATCTGT ATCGCCACGC AAGACTAGTA ACTTCTGCGG TGATCGCAAA GGTGCACACC ATTGATTGGA CCATTGAGCT TCTCAAAACT  GACATGCTTG TTGCTGGAAT GAGAGCTAAC TGGTATGGGC TATTGGGGAA AAGATTCAAG GACACATTTG GGCATGTTGG AGGATCTATT TTGGGAGGAC TAGTAGGGCT AAAGAAACCC  GAAAACCACG GGGTACCCTA CTCGCTAACA GAAGAGTTTA CAAGTGTTTA TCGAATGCAT TCTCTCTTAC CTGATCAACT TGTCATAAGG GATGTTAATT CCACACCAGG ACCTAACAAG  TCTCCAAAGA TTACCAAGGA GATTGACATG ATCAATTTGA TTGGAAAGAA TGGAGAAAAG GAATTATCAA AAATTGGATT TACCACACAA ATGGTATCCA TGGGACATCA AGCGTGTGGG  GCGCTTGAGC TATTCAACTA TCCAGTCTGG CTTAGGGACA TTGTGCCTCA AAACGTGGAC GGGACAGATC GCCCTGACCA CATTGACTTA GCATCACTCG ACATTTATAG GGATAGGGAG  AGGAAAGTAG CAAGATACAA TGAGTTCCGT AGATCACTTT TCTTGATCCC AATTTCCAAA TGGGAAGATC TAACGGAGGA CAAAGAAGCT ATTGCCACAT TGCGTGAAGT GTACGGTGAT  GATGTCGAAG AGCTTGATTT GTTAGTAGGA TTGATGGCTG AGAAAAAGAT CAATGGGTTC GCCATTAGCG AAACCTCTTT TATAATCTTT CTAGCCATGG CCTCAAGGCG ACTCCAAGCG  GATAGATTCT TCACTAGCGA TTTCAACGAA AATGTGTACA CGAAAAAAGG GTTCGAATGG GTAAACACAA CAGAGAGTCT GAAAGATGTG TTGGACCGAC ACTATCCAGA GATGAGCGAT  AGATGGATGA ACTCAACGAG TGCTTTTTCG GTGTGGGATG CTACCCCAGA ACCTCATAAT CCCGTACCAA TTTATTTTCG TCTCCCCAAG TGATAATGCT TTGATGGAAA AAAATATGTT  ACATGTTTGG TATATATGTA TAGGTATTGC ATCTGTTGGG GGTGCCTTAT TTAATCTATT TGCTTAGTAT GCGTTATTTA ATTTTCTTAT AGAATAAATG AATAATATAT TATATGTATC 
TTGATTAAAT AAAAGG 

Retrieve as FASTA