Entry information : HaDiOx07 (HanXRQChr14g0450081)
Entry ID 13776
Creation 2016-06-01 (Christophe Dunand)
Last sequence changes 2016-06-01 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaDiOx07 (HanXRQChr14g0450081)
Name (synonym) HaDiOx07 (HanXRQChr14g0450081)
Class Alpha-dioxygenase    [Orthogroup: DiOx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaDiOx07
start..stop
S start..stop
HaDiOx04 1130 0 1..626 1..643
HaDiOx06 1128 0 1..626 1..643
HaDiOx05 1076 0 1..626 1..629
NatDiOx01 951 0 1..625 1..641
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 140667151..140667270 120 N° 2 140667344..140667556 213 N° 3 140670176..140670325 150 N° 4 140670405..140670541 137
N° 5 140670794..140671007 214 N° 6 140671105..140671250 146 N° 7 140671348..140671575 228 N° 8 140672338..140672540 203
N° 9 140672625..140672868 244 N° 10 140672972..140673197 226  
join(140667151..140667270,140667344..140667556,140670176..140670325,140670405..1 40670541,140670794..140671007,140671105..140671250,140671348..140671575,14067233 8..140672540,140672625..140672868,140672972..140673197)


exon

Literature and cross-references HaDiOx07 (HanXRQChr14g0450081)
DNA ref. HanXRQ genome:   HanXRQChr14 (140667151..140673197)
Protein sequence: HaDiOx07 (HanXRQChr14g0450081)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   626
PWM (Da):   %s   71712.18  
PI (pH):   %s   8.8
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKSFMSFAKHLRLSPTKHFIHPDFHKIYEKMRPIDKPLFLIVHGVDKSRIGWHRFPVFLGLTYLGIRRSLHDKYNLLNVGDTPVGDRYDTLKEGEGTFFGRNMLPVDQKDKVLKPDPMVIATKLLARKQLIDTGKQFNMIAASWIQFMIHDWIDHLEDTKQIEELKAPTEVASGCPLKSFMFYKTKEFDTGLSDIKKGYRNIRTPWWDGSVIYGNHPKAAHRVRTFINGKLKIAEDGLLQHDNDGLPISGDIRNNWIGVSTLQALFIHEHNAVCDALKEYPYLDDKKLYHHARLVTSAVIAKIHTIDWTVELLKTDMLVAGMRANWYGLLGKRFKDTFGHVGGSILGGLVGLKKPENHGVPYSLTEEFTSVYRLHSLLPDQLFIRDVNSTPGPNKSPNITKKLDMINLIGKNGEKQLSEIGLLAQMVSMGHQACGALELFNYPVWLRKIAPQNVDGTDRPDHIDLASLIYRDRERKVARYNEFRRSLFLIPISKWEDLTEDKEAIATLREVYGDDVEQLDLLVGMMAEKKIKGFAISETAFVIFLIMASRRLQADKYFTSDFNEDVYTKKGLEWVNTTESLKDVLDRHYPEMTDRWMNSTSAFSVWDAAPEPHNPIPIYFRLPK

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGTCATTCATGTCTTTTGCAAAGCATCTACGTCTTTCACCCACCAAACACTTCATCCATCCTGACTTTCATAAAATCTATGAAAAGATGAGACCCATCGACAAGCCTCTCTTCTTG
GTACGTTAATGCTGCATGCATGCATGTAATCAAGTTAATAATTTATTCAATTTCCTGATTTTTATTTTGGCAGATCGTTCATGGTGTCGATAAGTCGAGGATAGGGTGGCACCGTTTTCC
GGTGTTCTTGGGGCTTACTTACTTGGGTATACGTCGCAGTCTTCATGACAAGTATAATTTGCTCAATGTTGGGGATACTCCCGTGGGGGATCGGTACGATACTTTAAAAGAAGGTGAAGG
AACTTTCTTTGGTCGTAACATGCTCCCTGTTGATCAGAAAGATAAG
GTATCGTGTTCTATAATATATTTCATGTTAGCTGTCTTTTCTAGTATTTTTTTAAAATGTTGAATTCATGATTG
GTGAAGTATGGTTAGGGTTTCGTGTAGTTTTTTTTTTTTTTTTTTTTTTTTTAACGGCCAACAAAATCAATTTCGAGCACTCTCATTAATGGACTAAACGGAGTATTCTGAGAGTAACCC
GAGTCCACCAACAATTCCGGAGAAAACACGGTAACCCACCGCATGTAGACACGACGGTGAAATTACCGGTAAAACCCGTTTGGCTCAAGGATCGAACCCAGGTTTCCCTGTGTCCAAGGG
CGTAGCTTAAGAGGGGCCGGGAGGGGCGCCCGACCACCCGAACTTTTCGCTCAGTAGTGTTATATATGTAGTTTTCGTATAGAAATTTTTGGGTATATACGTTTTCGACCCCCCGTTTCT
ATAGAAATTTTTGGGTATATACGTTTTCGACCCCCCCGTTTTCATGGTCAAGCTTCGCCACTGCCTGTGTCCCCTATCATTGCCCACCAATGCCTCACTCTACACCAAGTGGGAGTTAAA
CCTGCATCTCCCAAAAGAAATTGCAAACATTTCACCACTTAATCTAGAGATCATTGGCCTTTCGTGTAGCTTTGATTTGTTAGTTTTTTTTTCGATTTTAGACGTAATAGGTGATTTTTT
TTCAAATGTCTTGTAAGATGTTTAGAATGATATATAAAGAGATATAGCATTTTTCATAGCATAAATCTATACATCCAATCAATCATACCGAGTATATAATCCTAGTCAAGCTACTAGTGG
GGTTTGGAAAGGATGGGATGTAGACAAGTCTTATCTCTATTTCAAAGGATAAAGAGGCTGCTTTCGATAAGACCCCAGCTCCAAAGCCACATTCAACCGCGTCAATTGAATCATAAATAG
GTATATAACTACTTTAAAAGCAATCAGAAAACATAAGTCGCTGAAAATAAAATTTTTGAATCATATATCTATCAGTTATGTCTATCTTAAGTTAAATTATAGAAATGTGTGCTCAGGGCC
GGCTATGAGCAAGTGCCGGGTGTGCGTCGGCTCAGGGCCAAAATCGTAAAAGGGCCCGAAATTTTTTTAGAATTTATATATTTTTTTATATAAGATATATATACTACATGATACAAAATA
GGGAAACAAAATCAATTTGTTCTAGTGGTTGGTAGGCTCCGTTTTGAAGCATAGGACCCCGGATCGAATCTATTTTCTGGCTGACTTTTTTCTTTGTTTTTCTGATTGGGAATTCACAGA
TATTAAAATGTTGTTTTCTTTTATTAATGAATTCATTAGTATTTTATTTGAAGGACTCTAAAGGACTCGTCTAAGAGCTTAATTAATTCAAATTTTAACATAACAAAATCATCAAAATCA
TGTAATTTTAGGGGCTTATTGTTGTTGATCCTTTTCCCTTCTATTATTTAACTAAATGCGAGGGATTATTTATGCTTATGTACGTTTTAACATAAATTTTGTTTGGAAGCAAATTGGGTT
AAATATATACGTTTTCATTCGATGGTTTAAATTTGAATTGCTATACGTTTCGACGTAAATTTAGTTTGGAAACGAGTTGGGTCAGTTGTAATCTATACTTTATCACGTCGCCACTGCACA
TTGTGTATGTTTTGAGCTGGTCTCCATTTCGATGTAAATTTTATTTGGAAACAAATTGGGTCATATTTAATATATTTTCATTCAATGGTATGAATTTGGATTACTTTACGTTTCAACGTG
AATTTAGTTCGGAAACGAGTCGGGTTAACAGTGGTCTATAATTTATTCGTCGCGTATGGCGTTGCCGCAATGCACAACGTGTAAAAAAGCTAATATTATATTGAATTGAAACATTCAATG
TTTTTATTTAGACACTTTGAATATTATATTATTACAGGGCGGATAGGGCCCTATTATTTTATCTCGCCCAGGGCCCAAATTTGTTTTAACATTTTCAGAGACGGGCCTGTGTGTGCTAGT
CTGGCAAATAATATATAAAAGTACGATACACTAAGATTCATTGTTCAAGAATTTTTTATACCCTCTTGTTTTATTTGTTTTTAAGTTTTTTTATACCCTCTTGTTTTATTTCTTTAAGTT
AGTAATGTAGTAGTTATTGGCAGTACATGAACATTCTAACTACTACCTCCGCTAATGCATTAAAAATATGTAAAGTATAATAAAAAAAGCAGGAGAGTTAAGATCAACAATGATAGTTGA
ATAAAAATATGTTTGAAAATATAAATTGTACAATGCTCTCATGACATTAAATTTTTGACAAATTATAAAGAGGAAAAGTATCTACTTGTTAAGAATGATAAATCAATATATAAAAAAAAT
TAGAAATGCATGTCACGTTTTTATTTATATCATTACCCAAGTAAATAGAAAGTTTTGTGTTTTTCCTCATAGTAACAGTTGTAAAAACAAAATATATATTTCTCTCTTGAAATAATATCC
TTGTCGTGTGGATTCTTGCCTGAAGCTGAATTAATGTTAGTATTATTGGAATTGACTAAATCAGTTAAATAAACTTCATATAGAATATCGTAGAGAAGTTTTAATGTAAAGTGAGAGAGA
TGTATTAAGCTGTAGTTTTGTGCAGGTATTGAAACCAGATCCGATGGTGATAGCAACAAAGCTTCTAGCACGTAAACAACTTATAGACACCGGAAAGCAGTTCAACATGATTGCTGCTTC
ATGGATTCAGTTTATGATTCATGATTGGATTGATCACCTCGAAGATACAAAACAG
GTTCGATTAATCAATATTATATAATCTTATGATATAGAAGGATAAATTGAAGTACCAACATGTAT
GATTTAAATTACAGATTGAGGAGCTTAAGGCGCCAACGGAAGTAGCCAGTGGATGCCCTCTCAAATCCTTCATGTTCTACAAGACAAAAGAATTTGATACTGGTCTTTCTGACATTAAGA
AAGGTTATCGTAACATCAGAACTCCTTGGTG
GTATGATTTTCAACATATTATTAATAATAACTAGTAAATTTTACTTTTAATGCAACATGTGGTTTAATTTAGTAACGATAACTAGTTCC
ACAATAGTAAAACCCAATGATGATGTGGTGTTTTTTGGAGGCTAAAAACGAGAAACAACATCCTATTGTGAATGCTCTAATTAACGATATTATAGTTTTAATTATAATAATATTTTGGAT
GCATGATAATCAGGGTTACCATATATATAATATAATCGTACAGGGACGGGAGTGTGATATATGGAAACCACCCAAAGGCTGCGCATCGTGTTAGAACATTCATAAACGGAAAGCTAAAGA
TTGCAGAAGATGGCCTCCTCCAACACGACAACGATGGATTGCCCATCTCAGGCGACATTCGTAACAATTGGATCGGGGTGTCAACACTGCAAGCCCTCTTCATCCACGAGCACAATGCCG
TATGTGACGCCTTAAAG
GTATATATATATGTGTGTAGACAAGACAATCAAGTGGTTATTTTTAAATTTACCAGCTAGTAGCATTTCTCACTTACAATATACTTATACCAATCAGAAAGAA
TATCCTTATTTGGATGATAAAAAACTGTATCACCACGCAAGACTAGTAACTTCTGCGGTGATTGCAAAGATCCACACCATAGATTGGACCGTCGAGCTTCTCAAAACCGACATGCTTGTT
GCTGGAATGAGAGCTAACTG
GTAATCACTTACTTTCATTGACCTGGTCTTATGTGTTAGTTACATTCTTGAAATCAAGCATATTTACTAACATTTTGTTGAAATTTGATATATAAAGGTA
TGGGCTATTGGGGAAAAGATTCAAGGACACATTTGGGCATGTTGGAGGATCTATTTTGGGAGGTCTTGTAGGGCTAAAGAAACCCGAAAATCATGGGGTACCCTACTCGCTAACCGAAGA
GTTTACAAGTGTTTACAGATTGCATTCTCTCTTACCAGATCAACTTTTTATTAGGGATGTAAATTCAACACCAGGCCCTAACAAGTCCCCAAATATTACTAAAAA
GTAAGACCTTCACAC
TCAAGTTAACTTACATAGGGTAAAGTTCTTGTACAAATAATCTTAACATACTAAACATACAAATTGAAGGAAAACTCAAAAAGACAAGGTGGCATTTTTGTAATTATCAATAACTATCAA
AGTTACTCTACAAATATACCTAAAAAAACCTAACCACTCCCCCACCTCCAAAAAAACCTAAACCCCCCCCCCCCCCAAAAAAAAAAACCTAAAAAAACCTAACCCCCCCCCCCCCAAAAA
AAAAAAAAACCTAAACCCCACCCCCCACCCCAAGCTAAAATGCTAAAAACTAAACCCCCCAAAAAACCTACAAAAATCTAAAAAAATAAAAAAAAAAACACACAAATTATTTTATTTTAT
TTTATTTTTTTAACATTTTTTATTAAAAAATCGCTACTTTTAGTAGCAGCCAAAAAAAAATTTTTTTTTTTTTTTTTGCTAACGAAATGTAGCGATTTTTTAATAAAAAATGTTAAAAAA
AAAATTTGTGTTTTTTTAGGTATTTTTGGTTGTAACTTTGATAGTTGGTGGTAATTACAAAAATGCCACCTTGTCTTTTTGGGTTTTCCTTCAATTTGTATGTTTAGTATGTTAAGATTA
TTTGTATTTGATCTTTTGCCAACTTATATAACCTACTTCTTGTTATAACCATGAAGGTTTATTGAACATATGTTTAAGCATGCATGTTTGTTCATCTAATAACCAATAAATAAGTATGCT
CATAATTATGAGTTTACACGCATGCAGGCTTGACATGATTAATTTGATTGGGAAGAATGGAGAAAAGCAATTATCAGAAATTGGGCTTCTAGCACAAATGGTATCCATGGGACATCAAGC
CTGCGGGGCACTTGAACTATTTAACTATCCAGTCTGGCTTAGAAAAATTGCGCCTCAAAATGTGGACGGGACAGATCGCCCCGACCACATTGACTTAGCATCACTTGAGA
GTAAGCTACT
ATTTTCTTTCTTTCGTTCGTTCACTAAAGAATTGAATGTCCGTGTGTCTAAGATATGTATGATGATGCACACAGTTTATAGGGATAGGGAGAGGAAAGTAGCAAGATACAATGAGTTTCG
TAGATCACTTTTCTTGATCCCAATCTCCAAATGGGAAGATCTAACGGAGGATAAGGAAGCTATTGCCACATTGCGTGAAGTGTACGGTGATGATGTCGAACAACTTGATTTGTTGGTAGG
AATGATGGCTGAGAAAAAAATCAAAGGGTTCGCCATTAGCGAGACAGCTTTTGTAATCTTTCTAATCATGGCGTCAAG
GTATATATATAAATCACCAACATAGGAGAATAAAAACCTTAA
AAGACCAAACTGATTGATCGAGTACCATATATACATACTAAATATTTGTTTGTGTGCGCAGGCGACTCCAAGCAGATAAATACTTCACAAGCGACTTTAACGAAGATGTGTACACCAAAA
AAGGACTTGAATGGGTGAACACAACGGAGAGTCTAAAAGATGTGTTGGACCGACACTATCCAGAGATGACCGATAGATGGATGAACTCAACAAGTGCTTTCTCGGTGTGGGATGCTGCCC
CAGAGCCTCATAATCCTATACCAATTTACTTCCGTCTTCCCAAATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGTCATTCATGTCTTTTGCAAAGCATCTACGTCTTTCACCCACCAAACACTTCATCCATCCTGACTTTCATAAAATCTATGAAAAGATGAGACCCATCGACAAGCCTCTCTTCTTG
ATCGTTCATGGTGTCGATAAGTCGAGGATAGGGTGGCACCGTTTTCCGGTGTTCTTGGGGCTTACTTACTTGGGTATACGTCGCAGTCTTCATGACAAGTATAATTTGCTCAATGTTGGG
GATACTCCCGTGGGGGATCGGTACGATACTTTAAAAGAAGGTGAAGGAACTTTCTTTGGTCGTAACATGCTCCCTGTTGATCAGAAAGATAAG
GTATTGAAACCAGATCCGATGGTGATA
GCAACAAAGCTTCTAGCACGTAAACAACTTATAGACACCGGAAAGCAGTTCAACATGATTGCTGCTTCATGGATTCAGTTTATGATTCATGATTGGATTGATCACCTCGAAGATACAAAA
CAG
ATTGAGGAGCTTAAGGCGCCAACGGAAGTAGCCAGTGGATGCCCTCTCAAATCCTTCATGTTCTACAAGACAAAAGAATTTGATACTGGTCTTTCTGACATTAAGAAAGGTTATCGT
AACATCAGAACTCCTTGGTG
GGACGGGAGTGTGATATATGGAAACCACCCAAAGGCTGCGCATCGTGTTAGAACATTCATAAACGGAAAGCTAAAGATTGCAGAAGATGGCCTCCTCCAA
CACGACAACGATGGATTGCCCATCTCAGGCGACATTCGTAACAATTGGATCGGGGTGTCAACACTGCAAGCCCTCTTCATCCACGAGCACAATGCCGTATGTGACGCCTTAAAG
AAAGAA
TATCCTTATTTGGATGATAAAAAACTGTATCACCACGCAAGACTAGTAACTTCTGCGGTGATTGCAAAGATCCACACCATAGATTGGACCGTCGAGCTTCTCAAAACCGACATGCTTGTT
GCTGGAATGAGAGCTAACTG
GTATGGGCTATTGGGGAAAAGATTCAAGGACACATTTGGGCATGTTGGAGGATCTATTTTGGGAGGTCTTGTAGGGCTAAAGAAACCCGAAAATCATGGG
GTACCCTACTCGCTAACCGAAGAGTTTACAAGTGTTTACAGATTGCATTCTCTCTTACCAGATCAACTTTTTATTAGGGATGTAAATTCAACACCAGGCCCTAACAAGTCCCCAAATATT
ACTAAAAA
GCTTGACATGATTAATTTGATTGGGAAGAATGGAGAAAAGCAATTATCAGAAATTGGGCTTCTAGCACAAATGGTATCCATGGGACATCAAGCCTGCGGGGCACTTGAACTA
TTTAACTATCCAGTCTGGCTTAGAAAAATTGCGCCTCAAAATGTGGACGGGACAGATCGCCCCGACCACATTGACTTAGCATCACTTGAGA
TTTATAGGGATAGGGAGAGGAAAGTAGCA
AGATACAATGAGTTTCGTAGATCACTTTTCTTGATCCCAATCTCCAAATGGGAAGATCTAACGGAGGATAAGGAAGCTATTGCCACATTGCGTGAAGTGTACGGTGATGATGTCGAACAA
CTTGATTTGTTGGTAGGAATGATGGCTGAGAAAAAAATCAAAGGGTTCGCCATTAGCGAGACAGCTTTTGTAATCTTTCTAATCATGGCGTCAAG
GCGACTCCAAGCAGATAAATACTTC
ACAAGCGACTTTAACGAAGATGTGTACACCAAAAAAGGACTTGAATGGGTGAACACAACGGAGAGTCTAAAAGATGTGTTGGACCGACACTATCCAGAGATGACCGATAGATGGATGAAC
TCAACAAGTGCTTTCTCGGTGTGGGATGCTGCCCCAGAGCCTCATAATCCTATACCAATTTACTTCCGTCTTCCCAAATGA

Retrieve as FASTA