Entry information : PretGPx01
Entry ID 13799
Creation 2016-06-23 (Harold Duruflé)
Last sequence changes 2016-06-23 (Harold Duruflé)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-06-23 (Harold Duruflé)
Peroxidase information: PretGPx01
Name PretGPx01
Class Animal glutathione peroxidase    [Orthogroup: Gpx1004]
Taxonomy Eukaryota Metazoa Chordata Actinopterygii Poeciliidae Poecilia
Organism Poecilia reticulata (guppy)    [TaxId: 8081 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PretGPx01
start..stop
S start..stop
DrGPx02 320 1e-113 1..188 1..189
CapGPx02 306 2e-108 1..189 1..189
BtGPx02 306 3e-108 1..189 1..189
CjaGPx02 305 6e-108 1..189 1..189
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..222 222 N° 2 406..759 354  
join(1..222,406..759)


exon

Literature and cross-references PretGPx01
Cluster/Prediction ref. Genebank:   103458513
Protein sequence: PretGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   191
PWM (Da):   %s   21626.95  
PI (pH):   %s   6.51
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTFIAKTFYDLRATSLEGDSVDFNVFRGRVILIENVASL*GTTTRDFSELNQLQSKYPHRLVVLGFPCNQFGYQENCTNGEILHSLQHVRPGGGFKPNFTLFEKCDVNGANTHPVFAYLKCKLPYPEDDPSSLVQDPRFLVWSPVSRADVSWNFEKFLIGPEGEPFKRYSRNFPTIDVEPDIQRLLRLTKT*

Retrieve as FASTA  
Remarks
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAATAGCATC CACTTCCTAA TGGCATTTCA TTCATTACTG TCAAAGCTGA CAAGATGACC TTCACACTTT TAAGCCTTAA TAAATGAGGG TGATATTCTA AAACGTTGGC AGAATATCAC  CTGAAGTCAA ATAAGTGCTT AAAATTAGTG GATGTTATTT TCATTTTTCA GTGATTTATT CATTTCAAAT AATAGTGTTT TATAGAATAT GAAAACTTAT TCTGTAAGTT TTGTTTCTTG  TCTTACATAA GTGCTACCAG CAGATGGTGC TACCCAACTA ATCATGCAAA TAGAAACTCC AGTCATGCTT TTATGAATTG GCATTCCAAG CACAATCGAG AATGCACAGA AATAAAATCT  TGAAACTCAC ATTTGTGTGT TTTATTATTT CATTCATGTT TAATACAAAT TCCAAATAAC ATCTGCTTGT CAAGCAAAGC TCACTGTAAA GTGGTTGAAA ATCCCAAAAA TAATGAATCT  TGAAATGTGG CAGAAGGAAT CTGGAATTGT CTTCAGCACC TTTTAAAATA ACCGACAGGA TATGCATCAG CATTACTCGG TGGCCTGTGG GCAGCCAATT ACTTAAGCTA CATTTCCAAG  TAAAATTTGC TGATACAAGT AAACCACGCA GCTGCAGGAA TGCATTACTG CCACATTGCT TCCTGAAGAA GAGCCCTGAA TCAGTCATTT AAGCGTCGGC ATTGCTCTGG TGTGATAAGC  TCTCATCCAG CTTTGGTTTT CCACGTACGG AGGGCTTTGT TTGGAGGGTC CGCAGATTAA CGCCGGATTT TCTGGACATC CGCTCACATT CACATCAGTT CATGATGTCA GAGCTACCCT  CAGCACAGGC CAAGCAGCGT CCTGATGGGT TTTGCATTGG ATGCACTGGT GTCAAACACT GAAGCTCGTA AGGCTTCACA GCTTTTATTC CTGCTTGTCT TGGCTCCAAC TTTACATTTC  TGTGTGACCA CTCGACTATA GTCACATTCA AACACCAATT CATTGTTGTA GTAATTTTAA TGGGCAGAAC AGTTAGAATT TCCTCCATGT TAAGGCAGAA AAGACAAAAG TTGTTATTTT  TGGTCTCAAA AATGTAAGAT AATCAGCAGG ACATTCAGAC TTCATGAGGC TAAAGAGAAG ATTCTTCAAT AAACCTAGTT GTTGTAGGGG ATTCAGATTG TTAGCTCCCA TATAAAGTCT  ATTTTAAAAC AGTTCGCCAT TCTCTTTAAG ATATTGGCAA AATAAGGGCT TTCCTGTCAA ATTAGCACTC GCAATAATAC CAGGACTTCT GATATGATAT GACTGTCCTT TGGACAGATG  AACCAAAAAT GTAATTATTT AGACACCAGA GCAGAGGGCA TGTCTGGCCT AAACAAACAA ACAAACAAAC AAACAAACAA ACATGTATCA TGGTTAGGGA AAACTATTCC TCAGCAGGAC  TGGACCATCT CACCATCATA GAATCCACCA ACAACTGTGT GTTAGAGGCT GTTTTGAGGA AAATATGGGA CTACCTGAAG GAAAAGAAAA ATGCTAAAAA CCATGCTAAA AATCATGCTA  ATCACATGTC AGGAACCCCT TGGTGCATTT TTGTTTTTAT CTTTTGTTTA ATGGTTAAAA CAAATTTATT TTTGTTGTTT ACCTGCAATT AATTAAATCT TATTAAATAT AAACGTGAGA  AAATTTCTTA ATTAAGGACT GAATATATTC CAGAGGAGTG TCGTGTGTTT TCCAATCACT GTGTTTTTCA AGACAGAGTG AGAACTCTTT CTTCTTACTT TCACGTTTCT TTTTTTTTTT  TTTTTTTTTT AAACATTTAG TGAATTGAAn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn 
nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn TTTTTTTTTT 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGATATTTAT AAAAAATGTT ACTATAAGTA CTTATTCTGA ATACTTTTAG AAGAGCGAAA CTATATTGAG GTGCTGCTAA ACACAAGGTG TTTAATGTCT CTAAAGGAGA CTCGGATGTG  TGATTTTAAG GACAAAAAAT GTTTGTGGCA AAACTTTAAA TAATATATGT TATCTGTAAA TGTTAAGTTA AAATAAATAT GCATGGCAAT GTTCATGTTT AAATAAAATA AAGTGCAGTC  TGAACTTTGC AGAATTTTTT TTTTCTATTA GAACTAAATG TTAGGTGTGC ATCGAGTTCA GGCAGTAGCT TCATGTATAT TTCATCAGAT GCCGACAGAC AGGTGAATGT TTAATTTTTG  ATGACTAAGA AAGCTGATAC ATGCACAAAG ACATGCCTGA AAGCCACACA ACACTGGTCA ATACTGGCCT CCCAGAACTC ATCCTAATTA AGATCAGTAC CTACTGCTGC TGTGTTGCAT  AACGTGAAAC CTCTGTGTAT TCTAGTAGGA TTTTAGAAAA TAGTGATAAA TTATGAACTA CAAGAAAAAA AGTTGGTAAA TACACAAAGC TGATAGAGAG ATAACCCAAA TGACTTCAGC  CTTCGCTGCA AGTAAATCGG TTCTGCATAG TGTTGATTCA CACTGGCTGA ATCCAAATGC ACATCAACCT TTTCAGGTAT TTTTAATTGT ACAATTCTTT GAATACATTG TGTTCTTTTA  TTTCCACTTC TCAAATATGC ACTACTTGTC TTTTATCAAC TGAATTAAAT CCCAATAGAA TACATTGAAC TTGTGGTTGG AAAGGCATTT TATGTGCTGT TAGCTTTTAC AGTCAGTTTC  CTTCCTCTAT GTATCTCATC AGGAGATCAG TTTCCTGCAG GGCTACCCGA CACTTGTGAA AGGCGACTTG CTTCTCTGAG TGAGTCAGGT GGTCAGGGGT TTGGATACAG TCGGATGCCG 
AGACCCAGTC TCCCTCCAGT GATACATCAA AGAAGCCAAG 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACCTTCATTGCTAAGACCTTCTATGACCTGAGGGCCACCTCGCTAGAAGGGGACTCTGTGGACTTCAATGTCTTCAGGGGACGAGTGATCCTGATAGAGAATGTGGCCTCCCTCTGA
GGCACCACCACCCGGGACTTCAGCGAGCTGAATCAGCTGCAGAGCAAGTACCCCCATCGGCTGGTGGTCCTGGGCTTCCCTTGTAACCAGTTTGGATACCAG
GTAAGTAATTCAGAGGAG
AACCTTTTTACTCATTTCCTGGAAGGAGAATTTAGACATCTTCCTACAGCTAGTAGGAAAAAAATGCCCAAACATCGCATGATTTTACATGTGATGTTTTGTACCTTTTTTATTTCCTTT
TAATTTATGAAATTTCTAAATATCGATATTGCCTGTTCTCTGCAGGAAAACTGTACCAATGGTGAGATTCTGCATTCACTGCAGCACGTGCGACCAGGCGGTGGCTTCAAGCCCAACTTC
ACCTTGTTCGAGAAGTGCGATGTCAACGGAGCAAACACACATCCAGTCTTTGCCTATCTCAAATGCAAGCTCCCTTATCCCGAAGACGACCCAAGTTCCCTCGTGCAGGATCCCAGATTT
CTTGTTTGGAGTCCAGTCAGCAGGGCGGATGTCTCCTGGAACTTTGAGAAATTCCTCATCGGGCCAGAGGGAGAGCCCTTTAAGAGATACAGCAGGAATTTTCCAACTATTGACGTAGAG
CCTGACATCCAAAGGCTGCTAAGATTAACAAAGACCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACCTTCATTGCTAAGACCTTCTATGACCTGAGGGCCACCTCGCTAGAAGGGGACTCTGTGGACTTCAATGTCTTCAGGGGACGAGTGATCCTGATAGAGAATGTGGCCTCCCTCTGA
GGCACCACCACCCGGGACTTCAGCGAGCTGAATCAGCTGCAGAGCAAGTACCCCCATCGGCTGGTGGTCCTGGGCTTCCCTTGTAACCAGTTTGGATACCAG
GAAAACTGTACCAATGGT
GAGATTCTGCATTCACTGCAGCACGTGCGACCAGGCGGTGGCTTCAAGCCCAACTTCACCTTGTTCGAGAAGTGCGATGTCAACGGAGCAAACACACATCCAGTCTTTGCCTATCTCAAA
TGCAAGCTCCCTTATCCCGAAGACGACCCAAGTTCCCTCGTGCAGGATCCCAGATTTCTTGTTTGGAGTCCAGTCAGCAGGGCGGATGTCTCCTGGAACTTTGAGAAATTCCTCATCGGG
CCAGAGGGAGAGCCCTTTAAGAGATACAGCAGGAATTTTCCAACTATTGACGTAGAGCCTGACATCCAAAGGCTGCTAAGATTAACAAAGACCTAA

Retrieve as FASTA