Entry information : PretGPx02
Entry ID 13800
Creation 2016-06-23 (Harold Duruflé)
Last sequence changes 2016-06-23 (Harold Duruflé)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-06-23 (Harold Duruflé)
Peroxidase information: PretGPx02
Name PretGPx02
Class Animal glutathione peroxidase    [Orthogroup: Gpx1002]
Taxonomy Eukaryota Metazoa Chordata Actinopterygii Poeciliidae Poecilia
Organism Poecilia reticulata (guppy)    [TaxId: 8081 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PretGPx02
start..stop
S start..stop
DrGPx04-B 322 3e-114 1..190 1..191
BtGPx04-A 290 1e-101 3..190 10..197
SscGPx04 289 2e-101 3..190 10..197
PretGPx07 283 6e-99 6..190 7..186
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..63 63 N° 2 804..898 95 N° 3 2104..2248 145 N° 4 2352..2503 152
N° 5 3120..3144 25 N° 6 3241..3300 60 N° 7 3467..3499 33  
join(1..63,804..898,2104..2248,2352..2503,3120..3144,3241..3300,3467..3499)


exon

Literature and cross-references PretGPx02
Cluster/Prediction ref. Genebank:   103479268
Protein sequence: PretGPx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   190 (170)
PWM (Da):   %s   21021.75 (18860.5)  
PI (pH):   %s   8.77 (7.43) Peptide Signal:   %s   cut: 21 range:21-190
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MWLRPTVLLGVVGSRGLVRAMCAQVDNWKTAKSIYEFSATDIDGNEVSLEKYKGHVCIIVNVASK*GKTKVNYTQLAKMHATYAEQGLRILGFPCNQFGGEPGTEAEIKEFAKGYNAEFDLFSKIEVNGDNAHPLWKWMKAQPKGKGLLGNSIKWNFTFLINKDGEVVKRYGPTDDPEVVEKDLPTYM*

Retrieve as FASTA  
Remarks
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCACCGCTTT GCGTTCCTCT ATTGCCTGAC CTCTCACGTG AACTTCAGGG TATTTGTGCG TGTGTGTCTG GACCAGTGAC GGACCTGTCT GTAAACCCAA CCTCGGGGTG GGCAGGGCCT  GATGACCCCC AGCGTGCAAC TTATTTCCAG AAACCGCTCA CTGCAAACCT TGTAAAGACC ACTTGAGAGG ACAGTTGTTA GCCAATATAG AGGGTTTGCA TCATTTATTT CACTATAAAC  AGCCATTCCT TTTTTTTTTT TCTTTTCAGT CCAAATACCA TAAGAGTTTA TTTGTTTGGT AATGAGTTTG CTTACCTTTT GTTTCGTAAG AACAAATGCC ACAAATAACT AGGCTTTATG  CAGAGCTAGT TTACCTTGCA CTTGTCAAAA AGCTTATTGT TGTAACGTAC ACTGGTAACT TATGGAATAA AATGAAGAAA ATAAAATGCT GTCTTGAACA TTCTTTTGGT GTTATGTTGA  TTTATTTACC TATATGTGAA TTTTGTCTTG CAGCAGAAAT TAGACGATTG CATCTGACAG GTTTTTTGTA CAATGCCAAT CCTTAAAATC AAAAGTGTCT CAAATAATAT TTGATAACAT  GTTAGATTTT TTTTTTTTTT TGCCCATTTA TAGGTTTTTC CAAATATTTC ATTTGAGAAA TGGACTTCTG GCATTCAGAA TTTCCACTGA CCAAACCATG CTTCCCATAT AGCTGTTCTC  TGGATTCTGC TTCTAAACAT GATCCATAGT TTTTGGAGGG ATTTCTAATT GCATTTTATT ATTTATTTTG TCTGAAGATG TTTTTTTTTT TTTTTTTTTA ACTTTCCTAT ATTATGGGGG  GCTTCAAATG TAAGGGAGGT TAACATAATA GATCACCTTG CAAACAGGTT TCTGCTACTG AAAAAAACTC AAACTGCAGC ACAAAGTTTT GAAAATAATG CTACTTTGCT TTCTGTTCAG  TGTTGACTGA AACTTGATCT AAAATCAAGA TTTGCATAAA CCAAAACAAA AGTGGTTTTG GGGATGAAAG ACGCTGTAAA CTGATTAGGA AAAAGTTCCA ACTGAAGTGA CAAAATATAG  CCAACGAATT TTTCTTGAAA TGAAATTAAT TTGGAAACAG TTTTACCATT TAAAATGTAG TTTTTGCATT GTAGTCATTT CTGGTCAAGT TGAAATATTT AAAAATTTGT CTAAATGTTT  TTTGTTTCAA GTCCTGGTGA GCTGGGAGAA ATTTCCGTTG GCTGCTGACA TCTCTTGGGA AGATTTCTGT TTGCTCCATC TCTAAATAAT AACGCGGACC GTGGTTTGCT GGAGTTCCAA  ATCGATGCCA ATCTGAAGAT TTGGAGCATG ATCCGTTTAG AGGCATTTAA TACTTGTCAG ATAATTGTTC ACTGACAAAT GGGCTACACT TATAGTCAGA GGCTCAAAAC ATTTTTAGGC  CTCTGTTCGC CTCGGATGCA ACATCACTGC ACAAACCTTA CTTTTTATTG TATTGCCTCC GAATGCATAA TGAAAAACGT GCAGTCGACT GCACATTTAG TTCAGCCCGA TGCAGACGCT  GCGTGAAGAG GATGACGCAC AGCAGCGGAG GAGATGATCA GCACCGCTGG CTCTTGAGGA TGACAGCGTC GCCGCAAAAA AAAAAAAAAA AAACATTCAG CGACAAAAAC ACATTGACCG  GAGAGTGATG GCCGTCGTCT GCAGCTGAAC CGGGAAACGC AGAGTAAGAT GAGATGCCCG GCCGTTTAGC GGCGAGTATC GCTGCATCTC ATTCCGTCTG AGGCAGACGA GGGTTGCGCA  TCGTCACAAG GAGCCGTGCG GGACATGGAC CCAGCAACTG CGGGAATCGG GAGTGATGGA AGCCCCACAG AGGAAGCGGC CGCCGGATCC AGTCTGGAGC TTGACTTTGG GGACACCGGT 
AGGTGTCGTA GCCTAAATGT GTTCAATGCG ATGTCAAAAT CTCATAGGAA CATTTTTAGT AGAGTCCTTT TTTTTTTTTA 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGCCCCGGTC TTTCTGCATG GAGTTTGCAT GTTCTCCTTG TGCATGTGTA GGTTTTCTCC AGGTACTCCG GTTTCCTCCC ACAGTCCAAA AACATGACTG TCAGGTTAAT GGGCCTCTCC  AAATTGTCTC TGTGGGTGTG TGTGTGTATG GTTGTGTGTC CTGTCCCTCT GTGTTGCCCT GCGACAGACT GGCGACCTGT CCAGGTGTAC CCCGCCTCTC ACCTGGAACG TTAGCTGGAG  ATGGGCACCA GCAACCCTCT TGACCCCACT AAGGGACAAG GGTGTTAGAA AATGGATGGA TGAGGATTTC TTTTCATTTG AAATTGGTCA CTTTAAGGTG TTTAAAAGAA GGGTACAGGA  TCGGTAAAAT AAATCTGAGT GGGTGTATGA TTTCAATGGG AAATAATGAA ACAGGTGCAG ATTCGTTTAA GGTTCATTAT ATTGGTCTTG TCTCGGAGAC AACTTATGAT TCAAATCTAA  ATTGAAATAT TATGCTGAGG TTCTCAATAA CTTGGTAATT TTACTTCAAT GTGGGGATTA ATACGACATA ACAGGAGCAA TTTGAATTCC CCCATAGGGG GGCCCAGAAG AAAATCTTTG  GGAACCACTA ACTTAGGGAA TATTAGCTTT CCCTCCCATT ATCTTACACA CTTGTCTTAA GTGTGTTTAC TAACAAACAC AGTGCACTTC TGATAAGGKT TCCATTACTA AAGCTTATGA  TCAATGTGAA GCAGCATTAA AAGTCAAATG TCATCACACT CAAAACAATC AAAAGTATTT CTTTGAAATG TAATTTCACC TTTTCAGGGA GTCTAGACTG TATGAAAGGA ATGATTGCAA  TATACTATGA ACATATTTAA TTAGCAAAAT CCTGATTTAA AAAAAAAAGC CATTTTTGTA ATATGTTGGT TAGAGCCAGT GTTTGCCGTA WTAACGTGGG CGGAGCTAAG AGAATTATTA 
ATGGGAGGAG ACTAGGACGT CATGTGATAA GAGTGGCCAT 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTGGCTGAGACCGACAGTTTTGCTAGGTGTAGTGGGGAGCAGAGGTCTAGTCAGAGCTATGGTAAGTATACAATTCTGTATAAAGTACTTATCCTGAGTCTTTTACTTTCGGTACGAA
GTGACACTATAATCTTTAGCCGCCTGAATGTTTGACCACATGTAGGTCACATTCAGGGCTTTTCTGCTTTTTGGTGCGGTGCACCATTCAAATGAGTCCGATGTTGTTACGTTTGTTATC
GTTAGCTTGAAGCTGCAGCAACGACAAAGCACGCTCTGTTATAAATTGKGCGTATTGCAAGTTCTGAGTTGGAATATTTTGGACGTTTCTCCAGTATGAARTACGTTTTCCAGTGAGCCA
TTTCATTTAAGGTTTCAGCGCGACTATGTTTCGTTKATTTGTAGAGGGCTCAAATATTCCGTTGTACYTGCTTTAATCCGTGGTGTATAAAAACAAAGCTCTTCCGTTTATGCCTAATCC
TGTTATTTTCCTCTTTGTTATTCAATAAGATTACGAACCACTGGAGATTTTCGGTTAAATCGCTTTTCTTCGCCCCCTTTTTCTCGGAAATGTCTTGCTCGGACACATTTGAGGGATRGG
GCGTGCGGATGGTGACACAAATGGGCCATAGTGCGCACAAAATGAGAACTGGTGAACTCGCGAGAAAATATGATTCATCTTCTTACTTAATCTTACTCCTGCCCTTTAGTYCATGCTAAA
GGGCAGGAGTAAGATCCAACCCTTCTMTTCGGTTATTGCATAATCATGTCATCTCACATGTGCAATATCTCTTCATATTTCAGTGTGCTCAGGTGGATAATTGGAAAACCGCCAAGTCGA
TCTACGAGTTCTCTGCCACAGACATCGACGGGAATGAGGTGTCTCTGGAAAAATACAA
GTAAAATATATTTACTGCACTTGGAAGCTCGGCTGTACCTTTTAAGTTCCAAATTCTGATGC
AACTTGGGCAGTATGCAGTCTATTTGGACATGCAAATTGATTTAAGACCATTTTTTTTAAAAGTACATATGTACAAATCCACTTTTTGGTGGATTTTGGGGAAAACTTGTCCTCAGGTAA
ACTAAAACTTTTTTTTGGCAAAAAGTTTACCAATATACCATGTTGATAACACTAAAGTGGAATAAATTGGTAACAAATTATAGTCTTTGTATGCATACTTTATCATACTTAAAATTTGTA
AGCAATTTTATATTGCTTAAAAATGCTTCCCTTTATTCCAAAGTGAAACTTAAGAGTCGTTTTTAGGTTATATTAAACTTTAAATGTATATCAAAGTTTTAACATTTCATTTCACATTAT
CCTACCTTCTTATGACCCTTTTTTTTAAAAAAAGTGCACAGAGCAACATGACCCCGCTCCACAGTCTCACCTTGTTTARCTTAACTAGTTAAAATGTGACTCCTTCGGTTTCCTTCATTT
ACACGGAAGAGAAATCTGTCTGTCCTGAGATAATTTACTCAAATAAGACAGTCACTGCATGGAACCCACCCTTCACTGTTAYTGATAGTTGGAGCTAAACTCTCCAACCTGCAGGCAACA
TCGATTAAGTAACTAAATGCTCACCACACTTGCAGATACCGTAACTGATTAACCCGCTAATATCGGCTTGTTGTTTTACTCTGTAAAGATTGTGAACATGAGTAGACGGATAATTTCATG
CATAATGAGCATATTTATTTCAACATCTAATACATTTAGCCAGTATTTATTCTCTAACTTTGCTCATGTCCATGTATGACTAAAACATACAAGCTAAAAATCAAAAGCAACATGAATAGT
TGTTGCTTGCCTGTTCTTTAATAACAGCAGTTCATATTATCTTGGTTTAAGCTGATTGTGGAGCTATTTGATGATGTGTTTTTAGGGTTATCATATCGTGATTCTCCTACCAATGAATGT
CTTTGTTTTAGTTGTGACGACTTTTTTCAAACTGCTTTTTTTTCCATGTAGTTAAGGGGGAAAAAAAATAACTTTACTTTATTCAGAAACTACTTGGGTTTGAAGCAGCCAGCAATGTCC
AGTTATACCTGCAGTGAAGTATTTGTTCCAACACTTTTGCCTTTTCTTTTTTTTTTCTGCCAGGGGCCACGTTTGCATCATTGTAAATGTGGCCTCTAAGTGAGGAAAGACGAAGGTAAA
CTACACTCAGCTTGCGAAAATGCACGCTACGTACGCTGAGCAAGGTTTACGCATCCTGGGCTTCCCATGTAACCAGTTTGGAGGACAG
GTAACGAACGCATCATAAAACTGATGTTAGTG
ACATTTTTCTAGATAGTTTTATGCTATATATATATATTTTTTATTTTTTAATTTTTTTCTTTGCAACTTAGGAACCGGGGACAGAAGCCGAGATTAAGGAGTTTGCTAAAGGTTACAACG
CAGAGTTTGATCTCTTTAGTAAAATAGAGGTAAACGGTGACAATGCTCACCCTCTGTGGAAATGGATGAAGGCACAGCCCAAAGGAAAGGGATTGCTTGGAAA
GTAAGTCAGTTTTCTGC
TTTTTTTTTTATTTATTTTTTCTTTGTGGTCACAGTCTAAAGCAGGTTCAAGCCACTACTTTACTTATGATTGTCATTTTTTTCCTTTAACCCAATCCTCAAGGCAATGCATCTCTGCTA
AATCGCTCTTGTAACAGACGATTGAATTACGCAAACCAGAGTTAAACGACCTTTGACGAGTTGTAGCTATTATAAATCTTGTGTGTGCAAGTAACAGAAGGTCTTAATGATGTGAAACAC
AAAAGGGGTTTTTAAATGTGTGCTGTATGAATGAATTCAGTTTTCGTTTATCAGAATACAAGGTATTAAAAGTTTCACATGACCACTTTGCGTCACCCCTCTTTCTGAACTAATGAACCA
TTACAGCTAGCACATTATCTCTGCCATCTGCTTTCCCCTGAAATTTGAAATGTGAAAGTTTTTGCAGGGCCCTCCTACTTTTACCTCTGCTTTTAAAAGCTTTCTTAAAATGCAAAAGTA
AACTGACATTTTATCAGTCGTCCTAAAGCTATACTTTTAAAATACTATTATTTAAAAACACTCCTATGCATAACTATAAAGGTTTGGTTGTAATTCTTATGCATTTCTTCTACCAACAGT
AGCATCAAGTGGAACTTCACAAAG
GTATGTTGGAAATATCTTTTTTGTTCACGACGACAGTCTTCAACCAAGCGTGTTAACTTTGACTTTTTTAAATTTTATTTATTTTTTGCTCTGCAG

TTCCTGATAAACAAGGACGGGGAGGTGGTGAAGAGATACGGTCCAACTGACGATCCAGAG
GTAATCCATTGCAGCTGCGTTTACATATTTCTGTACACGGCATCATGACGCTAGAGCCCA
TGGTCTTACACTTTGTCAAGTCTCGACCCTCAAAACCTTTGTCTTGATGAAAGCTTAGAAGCAACAAACACGCTTCTTTGAAACTCAAATGCGTTTCTTTTTGCAGGTGGTGGAAAAGGA
CCTGCCCACATACATGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTGGCTGAGACCGACAGTTTTGCTAGGTGTAGTGGGGAGCAGAGGTCTAGTCAGAGCTATGTGTGCTCAGGTGGATAATTGGAAAACCGCCAAGTCGATCTACGAGTTCTCTGCCACA
GACATCGACGGGAATGAGGTGTCTCTGGAAAAATACAA
GGGCCACGTTTGCATCATTGTAAATGTGGCCTCTAAGTGAGGAAAGACGAAGGTAAACTACACTCAGCTTGCGAAAATGCAC
GCTACGTACGCTGAGCAAGGTTTACGCATCCTGGGCTTCCCATGTAACCAGTTTGGAGGACAG
GAACCGGGGACAGAAGCCGAGATTAAGGAGTTTGCTAAAGGTTACAACGCAGAGTTT
GATCTCTTTAGTAAAATAGAGGTAAACGGTGACAATGCTCACCCTCTGTGGAAATGGATGAAGGCACAGCCCAAAGGAAAGGGATTGCTTGGAAA
TAGCATCAAGTGGAACTTCACAAAG
TTCCTGATAAACAAGGACGGGGAGGTGGTGAAGAGATACGGTCCAACTGACGATCCAGAGGTGGTGGAAAAGGACCTGCCCACATACATGTAG

Retrieve as FASTA