Entry information : PretGPx03
Entry ID 13801
Creation 2016-06-23 (Harold Duruflé)
Last sequence changes 2016-06-23 (Harold Duruflé)
Sequence status complete
Reviewer Harold Duruflé
Last annotation changes 2016-06-23 (Harold Duruflé)
Peroxidase information: PretGPx03
Name PretGPx03
Class Animal glutathione peroxidase    [Orthogroup: Gpx1001]
Taxonomy Eukaryota Metazoa Chordata Actinopterygii Poeciliidae Poecilia
Organism Poecilia reticulata (guppy)    [TaxId: 8081 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PretGPx03
start..stop
S start..stop
DrGPx03 285 3e-98 43..248 11..214
XlGPx03 262 6e-89 43..248 8..216
BtGPx06 261 1e-88 41..248 12..215
MmulGPx06 258 8e-88 64..248 32..215
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..186 186 N° 2 2600..2750 151 N° 3 2855..2972 118 N° 4 3493..3592 100
N° 5 4260..4472 213  
join(1..186,2600..2750,2855..2972,3493..3592,4260..4472)


exon

Literature and cross-references PretGPx03
Cluster/Prediction ref. Genebank:   103471137
Protein sequence: PretGPx03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   255
PWM (Da):   %s   28532.71  
PI (pH):   %s   9.56
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSALRPLPHMFISPEGEAGRHPQRAVTVSWIDGVMRPFSPPLLLLLLALLRPFAACGTDFVQWCDSSTAGTIYQYNARTLNGSRTVNFGDFAGKSVLFVNVATY*GLTFQYVELNALHEELKPLGLTILGFPCNQFGKQEPGTKSEILQGLKYVRPGNGFVPNFLLMEKGDVNGKSEQRVFTFLRSCPPVGDDFGAPYGRLFWEPLRINDIKWNFEKFLVGPDGKAVMRWHPRVNMSTVRTDIRNYLIRLYTQN*

Retrieve as FASTA  
Remarks
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAGTGATAGG TGCTTAAGTT TGTCGCTTTA AGTGATTTAG CAGTAGTCCA TGCGCAGGAG ATGTAAGGTA GCAGATTGGA CGGTGATGTG ACAGTTTCTG ATACGTGAAG ATGGCATGTA  GAATGAAGAG GAGGCTTGAA AACAGGAACT CTGTGGTGCC TCCTCTGAGT CTGGGGGTGC AGGAAAGCTT TTCAGTGCAT TCGAGCTGCC CTGTAATCCC ACAGCACCAT GGCATCTTCT  CCATCCCAGG AACTGTTTGC CATTACAGCA AAATCTGTCT TTTTTTTCTC TTTCTTTTTA AGCTTCAATA AATCATTAAG AAAGCCACCA TGATGTGCAG ACTTTTCTTC AACAGCACAA  CAGTTGTAAA TACTCTAGCC TGCGGCAGTA CAAAGACAAA ATGTGAATAA GACATTTAGA ATAGATTTAT TAAGCCAGTC AAATACAAAA ATTCTCACAT GTGCTTTTTG CCAATAGCAA  AAAGGAAAAA AAGAACGCTA TAAACCAGAA AAATACACCT GCCAGAAATT ACAGCATACC TTTCAAAGTG CAACTCTGCT GATGTCTCAG TTCTCACCAT TCAAATATTT TTGTTCCCCG  CAAACTTACA AACTCATTTC ACAAAAAACT GAGCCAAAGT CCCGTCCCGC ACAATTTGAA GCCCTTCGTC TAACTACTTG AAATACTTTA TACTAAGGAA ATAACTGGTG CTGAGGTAAA  ACCACTTTGA GATTGATTTS ACCATCTAAA AAAGTTGTAA AACATATTTC CAACATGTTG ATCCTGTACT ATGTCATGAG GTCTTCTGAC TTTGCAGACG AATCCCCTTG GCATCAATTG  CTGGTTGTCA ATTGGGACTG AAAGCGTCAA GACATCCTGG ACGCGTTATT TTTTTTTCTC CGAGGAGCAG AGCTGTAATA CGCAAGTTGT TGTACGAATA GGACTCTAAT CACACCTGCT  GCCTTAAGAT TTTGAAKCTC TGTTTGCAAC TGTGTGTTGA GGCTACAGTA AAAATGGTAC AGGATGCAGT AAAAATGAGC ATAAATATCA GAATGCGTGG TAAAACCAAG TAGAAGTGTC  GTTTAATGAG ATTAGGTCCA TTATCATGGA AAAAAAAAGG ATGTTTAAGT AATGTGCATT GTGTATTGTG TCTGATACAA ACATACAATG TCAATAGCTA CAATATATTG GGATTACACT  AACAACATAG AAAGAACAGC ATTACTAAAG ACAATGATTT ACACTCAGTA AATGCAACTA TCAAAACAGC AGGTTATAAA TAAATTATTA GTAATCACAA TCATGTTTTT TGGTTTTTTG  GTATCAAAAT TCATTTCCTC AAATTTTTGT ATTTCAACAA CCACTTTTGA ACAGTTACAC ATATTAGACA TTTCTAGAAC ATCGATGGCA CTGTAGAAAT CCTCATAAAA TCAATTAACA  TTCACATTGT TTTTACTTCT ATGATTTATT GTACCTATAT AATCATTCAG CGCTGGAAAT GAGCACGTGT TGTCCTATTT GCTTTTGGGG AATGGCTTCC AGTAACCCTA CAAGTTAATC  AAAGTGTTAA GGTGTTACAT ACTTGCAGAG AGACAATTAC ATAGGTATAT TTTGCAGAAG GGAAAAAAAA TAAAATAAAA AAAGAAAGCA ATGATAATTA TTCAAACTCA TTTAACAAAA  GGACTTCAGT TCCAGATAAA AAAATCTAAA TAATATGTAT ATATATTTAT ATATATTCAG AATAGCGAAG TGTTTCACAA ATAGCCTTAT AAAACGCAAG TATAAACAAC ATTACAATAG  GATATCTACA GTTCAGTAGG AAAATTATAT CTCAATCACA CCTTGTCAAC TCAAAGACAG TTTCATGCTA CTACCCAGAC TCCATCAGAT GAGTACGGTG ATGCTTTAGT GCTTTCCGGG 
GTCGATGTTC TGTCTCTCCC TTTTGCCAAA CCCTGTTGCT GTGGCTGCTG TTGACTGATC TGCAATGGAA CAGAAACAAA A 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCACTAAATC TTAATTTKAT TCATTTGAAT TTATTGATAT TACCTTCAGT CTGCTAATAA GCATCATTAA AGTATAATAT YTAGTTCCAT TCAGCATAAA GTCCATCTGA TGTTTTCCAA  AAACAGTACA CATCAGTTTC CTTGTATGCA ACTCCACCTT CTGGTTTGGG CCTTAAGTTA CAGTGCCTTG CAAAACTTGA CCTTTTAAAA TGCTGTAAAA TTATGACCAA CCACTTAAAT  GTATTTCACA AGGTTATCAT GTCATAGAAC AGCACAAAGT TCACAACTAC ATYACTGTAA AATGAAAACA GGGCTGCACA GGGGCACAAT TTGGACATKT GTGGGTTTTC TGGGTACTCT  AGTTCATGGA GTACAGTAAT ATAAGTTGCT GTTTAAAGGT TTTTGAAAAY TGGTATTAAA ATAACATTTT TCAAAAGTAA CACATTTAAA TTTTTATGAT TAATTATATR TTTACGCAGC  CCCTCATCTA TTTTTAGCAA CAGGATCTTA CTTAGCATTA TCCCTACAAA GCATTAAGAC AGTTTGTTGG CCTGGGGCAT CTCTGTTCTT CTCCATTGTC ATTTTAAAGT GACAGTTGTT  GAGACATCTC TCCCACTACT GCGTTGTCAG ATAAAGCCAC TGAGGTGCTC TGACAGGCAT GCAAAGAGGC TTGTCAACTT CCCACGGGGC ACATGGTCGA GTGGCAACTC ACTATGGCAA  CCGCTGATCC CAGACAAGAG AAATGATCCT TGAATAAGGA AACAAAAAAC CCGCTGTGTT TAGGGGGAAA AAAAACCTCA GCATGTTGCA TTCAGAGAAA CTGGGTCAAA CTGTCATAGA  AACTGACAGT TACATTTCAC TGTTTTTTAA ATAACTACTA TTAATCGTTT WTTATTATTA TTTTTATTTT ATCCAAATCA TCTCAACCAA AACTTCATTC ATCCATTCAT TCATCCATTC 
ATGTTTGGCA ACTATATCCG TGTCCGTCAG CAGATGGCGT 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCAGCCCTCCGCCCCCTGCCACATATGTTTATTTCCCCGGAGGGAGAAGCTGGGAGACATCCACAGAGAGCGGTCACAGTGTCGTGGATAGACGGCGTCATGAGGCCCTTCTCACCG
CCGCTGCTGCTCCTGCTGCTCGCTCTGCTGCGACCCTTCGCCGCCTGCGGAACCGACTTCGTGCAG
GTACCTGTTGATGGGAAATGTGTGTGCAGACAAATTCAATAGCCTGAAATCTGA
CGACATTTTTCTTTTCGTTATTTTTMTTTTTTATTTTTTTGCTATGGTCTGACTACACCTGYTTGCTTTTTGAGCATTTATTCTTTATCAAAGAATAAAAGCAGGATCTTTCAGGCGTCT
TATCAGATATTTGATGCCATTTATGGCATCGCCTATAATTGATGGCATAAATGCCAGCACCTATCAAAATACCAATTTATTGTATCAGTATATCGTGTTAGCGATTGTTAAACTATATTA
GTACATTTTGGCTAATTGTGTTTTCCTAATCATCAAAAGAACATAAAACATTTTGACCACAAAAATCCCTATTTTTCATCTCTCTCTCTCTCTCTCTCTCTCTCTCTCATATGAATTAGC
TTTGAAGAAAGATATTACCAACAGTGAGCTGCAAGACCTTAAAAAGATTGTTTTCAAGTGGATTATTTAAGATGTTTTGGTTAAAGGCTGTGCCTCTTTTTTGTAATGGAGCAAAGTTCC
TRTTGACTCTGGACTTATTTTGCGCTGGGACAGCTGGCAGTGGGGGAAACTCCAGTCCACAAAACAATAGACATGTGAAAGGGGAAACACATTTCACTTCACTTTTTATTTTATGGTTAT
CACCACAGGGAGATTTGCCTGGCAGCCAGGTGAACWTAAAAATAAGGAATTAGTCAGTATGTAATCAATGGTAAGTCAAACCAGAAAGGAACCATCTGTTCTGATGAAACTTAAGACATT
ACAATGTCAAGAGATCCATCAAGATGAAGGTTTTTGCTCTTCTTGCTGGTGGTCTTGTTAAAGCAGAGCTTATTAGATCAATAAACGTCACAATTCATGTAATAATTCGGGCCTTTAGAT
CTCCTGTGTTGTTAAGGTAACACACCCCAAGCTAATCAACGTATTAAGTCATGAATGCTTTACATGCTTAATGGTTTGAAAAATAAAATTCAAAAGTGTGGCGCGTATTAACCTTCAAGG
AAATCCAGCGCAACCAGCGATAATTTAGCGTGTGGAAGGAAGCTCCCTGAGCATCAGTATTAACACAGTGACACATGGTGACAGCATCACACTAGAGGAAGGATTTCTCTTTCCCAACAG
GGACAGGGAAGTAGGTTATAGTTGATGGGAAAAAATGGATGGGGCTAAATACAGAGCAATACTGGAAGAAAACCAGTAAAGAGACTGCAAAAGACTGGCCAAAGGTTCACCTTCCAGCTC
TGGCTGTTTCCAAACCAAACAGCCAGAGCTACRATGGAACGGTTTGGATCRAKGCATATTCTTGTGCTCAAAGGACCCAGTCAAAGTTTAATTAGCTTGGAAATATTGTTCATAAATGCT
CCCAGTCCAACCTGACTGATCCTGAGGAAGTTTTTAAAGAAGAGGYATAAATAAAAGGGGGTTATGAATACTGTTGCAAGACGTTGTGATTCATTTTTGATCCTTTTAAAACAAACCCGG
TTAGGGTAAGCGTCAGGTTCAAGCAACCTAAAAAAAACACTTTGACACAAATAAAAAGAAGAGAGAGACAAGTGATTATCCATTTCTCATGAGGAGAGCGATGAAGAGAGGAACGTGAGT
TACAGTCTCCACCTCGCTCTGAAGCTCTCATCCTCCGCTACACCTCTTTTATTACAAACTTGGGTGTTTTCTAGTCACAGAGTTTGCAAACTGCTAAGAGGAAGAGGGGGACAAACAAAA
ACTCAGCTTGCAAACAAGCTGAGTTTTTGGTCATGAATCTTCAGAGTACAATGAAACCCGCCCGTCTTCTCGTAAGGCCTTAAGCTCTGGTCCTGCTTCTGTGGGTCACAACCTTTGGCC
TTTATCTGTTTCTTCCAACGTATTTCCAACAGGTTGATCCTGTACAGTGTCATGAGGCCTCTCAGTCCGCCTGCAGTTTGGCTCCAAGGAATCTGACTTCTTGTTTTGTGGCTCTTGCAA
CACATTCCTCACACAGCACAAGTTTCAGAGACACACAGAAAGAATGCTAAAGACTTTAAAGACAATGATATACATAACATATATACATAATAAAAGTAAAAAATATTATTCACAACCTAA
CAGTAAATGAGTGATTTTTATGCTTGGTAGATGATTGTGGAATCACTGAGGTCAGTGGCCCCAGACTTGTGTTTAAATTAGTTTACGTTTCCACTTTGAATCTGGAATAAACTTCTTACC
TCTAACTTTTGCGTAGACGAAGGTGGGTACAGACCGTCACAGKGATCTGAATTTAATATTGCTATTTTTTTCATTTGCGTAACACGTAACAACAAAAACAAATCAATACTAGCAGCAGCG
GGTGACGCAGATGTACCTTTGTTAGAAGTACTTGATGTTCTGGCCAGAACAYTTTTTAACCTCGTGTCTGTACCCACAGTGGTGTGACTCGTCCACTGCTGGCACCATCTACCAATACAA
CGCAAGGACTCTGAATGGAAGTCGCACCGTGAACTTTGGCGACTTCGCCGGCAAGAGTGTCCTTTTTGTCAATGTCGCTACATACTGAGGATTGACTTTCCAGTATGTAG
GTAAGCAGCT
GCACACTGTCGTCTTTGTTATTGGAGCATTACTCCATTCGCCGTCTGAAATCATTTTTTGTTTTTTTGTTGTTGTTCCTGGCGTTTCCTTTCAGAACTGAATGCACTGCACGAGGAGCTG
AAACCCCTCGGTCTSACTATTCTGGGCTTTCCCTGCAACCAGTTTGGCAAACAGGAGCCGGGGACCAAAAGCGAAATCCTTCAAGGCTTAAA
GTAAGAAAACTCTTCCACTTTTTTTTTT
TTTTTTTTTTGTCAGGTCAAACTTGAGGCAGTCACAAAGAGGAACATTGTGTAAAGCTGATAGAGAAGTTTAAAGTAAATGCCATCAGGTGGAAGTTTTGTTTCCTCAAACTGCTACTTA
GAAGGAACTTTTAATCCAGGAAAATAATAGTGTAAAAATGTGAGAATCCCTTAAATTATAGTTCAGTGGAGACATTTACGTAAGTGATCATAACACTAGCTGGATCTGCAGAGAAATTCT
CACAGTTTGACAAAACTTCTAACAATCAAACTTTACGTAATCAAGAGAGTTGCCTATTGGTAATTTGATAACTTTCTTATTTTTGACCCTTTTATTTGCACATGTTGAAACCATGTCTGC
AGTTCCACAAATCATTACTGGTTTTTGGAATAACATCCTGAAGCTCCTGAGGGACTTTTTTGGGGCAGCTGTCAAACTGCAAAGTGCTACGAGCCGCGACCACTGATAAGACGCTTTCTT
TTTGGATGCCAGATACGTCAGACCAGGCAACGGATTCGTTCCAAACTTCCTGCTGATGGAGAAGGGYGATGTGAATGGCAAGAGCGAGCAGCGGGTTTTCACATTCCTCAAGGTAAGTTC
CAGGTTTTAAAATGAAAGGAAAAAGAACCTTGGAGTTGTGAATCCTGCATTCCAATCTATATGCTCCTTGAATAGCTCACTACTTAACATTCAGAGATATTGTTGTACAGCTAGCTATTC
TTGCTTACTCCAATGGCTAAATTACCACATACTTCACTGTACAGAACTTTATTTTATTGTTTCGCAACTAAAGATGATTTGTATTAAACTCCTTTACCATAAAAGCCCTAAATAAATCCC
AGTACAACTCAGCTGTCTTTGGAAGTCGTCCATATAAAGGTATTTAGGTAGATAAAGTAGGCAATGTGAAATTCAATCTTGGTATAAATAAATATATGAAGGCTTCAGAGGTTTGGTAAA
AGAACATTATTGAAGGAACAACTTAAAGACCAAGAAACACACCACACAGCAGGTCAGGGATACAAGTGTAGAGCGCTTTAATCAAAGCAGCATTGGCTTATAAAACAAAAACCCAAGCTT
GGGACACTGAGGACTGCTGATTCCATCTGAAATGCAAATCTGGCCTTTAGGGAGAAGTGGCAAAAAGAAAGCCATTGTTAAAAGAACACCACAAGAAGTCCCACTTCCTGCTGTGCAGTA
AAACCTCTAATTTTTCTCTCGTGTTCACAATTGATTTTCTCAACGTTCTGCCGTTCCAGCGCTCCTGCCCTCCGGTCGGGGATGACTTTGGCGCCCCTTACGGCAGGCTGTTCTGGGAGC
CTCTTAGAATCAACGACATCAAGTGGAACTTTGAGAAGTTTCTGGTGGGGCCCGACGGAAAAGCGGTGATGAGATGGCACCCACGTGTCAACATGTCCACGGTCCGAACGGACATCCGCA
ATTACCTTATTCGACTCTACACGCAGAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCAGCCCTCCGCCCCCTGCCACATATGTTTATTTCCCCGGAGGGAGAAGCTGGGAGACATCCACAGAGAGCGGTCACAGTGTCGTGGATAGACGGCGTCATGAGGCCCTTCTCACCG
CCGCTGCTGCTCCTGCTGCTCGCTCTGCTGCGACCCTTCGCCGCCTGCGGAACCGACTTCGTGCAG
TGGTGTGACTCGTCCACTGCTGGCACCATCTACCAATACAACGCAAGGACTCTG
AATGGAAGTCGCACCGTGAACTTTGGCGACTTCGCCGGCAAGAGTGTCCTTTTTGTCAATGTCGCTACATACTGAGGATTGACTTTCCAGTATGTAG
AACTGAATGCACTGCACGAGGAG
CTGAAACCCCTCGGTCTSACTATTCTGGGCTTTCCCTGCAACCAGTTTGGCAAACAGGAGCCGGGGACCAAAAGCGAAATCCTTCAAGGCTTAAA
ATACGTCAGACCAGGCAACGGATTC
GTTCCAAACTTCCTGCTGATGGAGAAGGGYGATGTGAATGGCAAGAGCGAGCAGCGGGTTTTCACATTCCTCAAG
CGCTCCTGCCCTCCGGTCGGGGATGACTTTGGCGCCCCTTACGGC
AGGCTGTTCTGGGAGCCTCTTAGAATCAACGACATCAAGTGGAACTTTGAGAAGTTTCTGGTGGGGCCCGACGGAAAAGCGGTGATGAGATGGCACCCACGTGTCAACATGTCCACGGTC
CGAACGGACATCCGCAATTACCTTATTCGACTCTACACGCAGAATTAA

Retrieve as FASTA