Entry information : PretGPx04
Entry ID 13802
Creation 2016-06-23 (Harold Duruflé)
Last sequence changes 2016-06-23 (Harold Duruflé)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-06-27 (Harold Duruflé)
Peroxidase information: PretGPx04
Name PretGPx04
Class Animal glutathione peroxidase    [Orthogroup: Gpx1005]
Taxonomy Eukaryota Metazoa Chordata Actinopterygii Poeciliidae Poecilia
Organism Poecilia reticulata (guppy)    [TaxId: 8081 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PretGPx04
start..stop
S start..stop
GgaGPx07 204 2e-67 43..210 18..185
BtGPx07 202 4e-67 42..210 19..186
OarGPx07 202 5e-67 42..210 19..186
SscGPx07 201 2e-66 43..210 19..186
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..207 207 N° 2 375..636 262 N° 3 3948..4111 164  
join(1..207,375..636,3948..4111)


exon

Literature and cross-references PretGPx04
Cluster/Prediction ref. Genebank:   103469974
Protein sequence: PretGPx04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   210
PWM (Da):   %s   23916.6 Transmb domain:   %s   i21-40o
PI (pH):   %s   10.5
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEALGGYPTKSSKARIKRLRVLVSMTVGVGCLFLLQTHLVKPRKQRDFYSFEVKDAKGRTVSLEKYRGKASLVVNVASHCQHTEASYKSLQDLHRELGTSHFNVLAFPCGQFGDTEPGFSRDIEAFAKSTYGVTFPFFSKIKILGTEAEPAFRFLTDSVQKIPKWNFWKFLVNQEGKVIRFWRTDESMESVRKEVTALVREIIIRKRGEL

Retrieve as FASTA  
Remarks
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCAAATGC TTGGTAGATA TGGGACATTT TGCCACTTTA TGTCAGATGG AGCCGTCCTG GTCAAGCCTG AAGTGACTGA AGTGTCGGCA GAGGGCGTGC GAGAGACATC TGTTGCTCCA  GAAAGAAGTG TTGGTATGGT TTTATTTGAG TGTTGGCCAT TCTATCGGAC AGTAACGAAT CCAGTGTTGG GTTTAAAAAA TAAATAAATA AATTTCTCTA TGGTGTACTT TTTAAAGTAA  TTTTCTAAAG TTTACAATCT TGTTTTTAAG ATGAAGCCTA CCTTTTCACC TTTCAGTGTC TGATTTGAGC CTCTTTACTG TATCTCATCC TTCCAACAAT AAAATAATGT ACTTCAAGAG  CATCAGTTGT TTTCTCCAAC GGGCTGCATG GAGATGCCCA TGTGACCGTG GTAAATGTTG CGTCTCCAAC GACTGTTCAA ATCCTCACCT AGGGCTTTTC TACATGGAGT TTGCATGTTC  TCATGCTTAA TGATCTCTGC AAAAAAGCCC CACCGTGCAC AGATAAGTGG GTGGATGAAT TGATGTTTTC TCTAGAGGTG ATGGTGTGCA ATACAGGCAA ACATCTCTTT TTTTTCCATA  AGTCTTATGG TTCAGATGCT ACATTAAGTC TTGGTACCAT TTTTATTATA TAGAAGCAAA CAAACGCCTT TTTCAAACTG TCTTGCAATG ACCTTTAGCG AAACAACAAC TTAGTCTTTC  TACACACAAC TTTTACTTTA GCTTTATGTT TATTAAAAAT GAGTACTCTG TGGTTTTGTA CATTTCAGTG TAGGTATATA GATATGCTTA GAGTACGTAC TGTACATCAT AATTCTTAGC  ACCTAAAAAC CAATAGCCGA AAGAGGATGA ACCTTCATAT TCACGGTGGT ATTCTTTTTT ACATTGCAAT GTAAAGGCAT TGAGTATTGC ACAAGATCAA GCAGCTGTGG ATTTCTCAGA  CAGTTTTGAG GGCAGCAGCA GGTAAGCTGG CACCTGACGA CCCAACCAGC TAACGAGACA CTGCCTACAA ACCAGCCGAA AAGCACCAGA GGTCCTTTAC CTAAAGATAT TTATATGAAA  AGTCCTCCAA CATTTGCAAG TTGAGCGTAA ATGTAACCGT TATGGTAGCA GAGCACTGTG AGCTGAAAGA GAACTCGTCA GCTAACATTA CACTGCCTCC ATACCAGTCA CAACTGAAAG  GTCTTCTGCA CCAAACACAA CTTGAGACAT TTTGCAGCCC AGCTTCAGCA GCAGGTATTT CTAAAGGTTG CCCTGATAGC ATCAGTGGGG ACGGAGGTGC AGCTGCACGC AACCAAATCT  GCTGCCACAC TGGCACCTCC ACCTCAAATC TGTAATCTAG AAATCGGGGA GATTCTGATA CAGAGATGTC CACTTTTCAT CTTACCTTGA AAGGGAGAAG GTCTTCTTAT CCTCATTAAA  GCATCTTCCT AACAAAGAGG AGAAATTAAA TAATTGAGCT CATAATTCAA AACAAAACGA GTTTCTGCAA AGTTGATCAG TAAGAACCAA GTAGGGGCTG TGATTTGTTG AAAGTTTGCA  TGTGTTGCCT AGGAGCAGCA GCAGCAGCAA CAGGTTAAAG GAATACAAAC AGGTTACAAC ACCACATATT TTAATTCCAT GATTTGATCT ACTTACCCAC TTTTTTGAAT GTCCCTATGT  GAATTTTTTT CCCCCCTCTT ACAGAGATCA CTTTTAACCC CTTCACCCCG CTGAGACCCG GGTCATATAC AGTACCTGCG GTCCCTCCTG CTCCAACTCC CCTCCTAAAT ACTCCTGCAA  GGCGGACAGC AGAGCGGGAA GCTGCGACTT CTGCTCTGCC ATTGGCGGCC TAATCCTGTT TTTTTTTCTC TCTCTCTCTC CTTTAAGTGG CTTGTCTGGT GATGCCATTT GCGTCCTTGT 
TTCCAGTGCA ACAATTAAGT AGACAAAGTA AAGAAAAACA GCAACGCGGT AAAGCTGTAA AAGAGGAGGC GGCAGCGTGC T 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTTTAATTAA ACTCTAAATT GACTCTAGCA GACTTTAAAT CTAAATAAAA ATGCTCCAGT AACACTGCTT GGAAGAAGAC CTGCAAATAA AAATAAAATC AACTGCTGAT ACTGGAATAA  TATTAAGTAA AAACATTAAC ATGTCTTTAA TGTCAGTGAA ATAATTAAAT ATATCTTACA ACCCAATGAA TAAGAAGAAC AGTTTGCAAA CTTGTCATGG GGATGTGAGA ACAATAAATG  TTTTTTTTGC TATACTATTT TCACAAACAG GAATTTTAAT CCTAATTTTG GTGACATCTT AGTTTCCTGA TCACATTTAA GATTATTTCT TATCTTTATC AGAAGGTGTT GCAGAGGTTT  GTGCAGCACC TTGCATGTCT TATTGCAGGA CATTGTGTTC TTGCATGTGT TTTCTCCGTG AAAATTCGAG CTCCGACAGA ACGTGTAAAA TTCAAAGAGG GAGTCACAGC GCCCCCCAGA  GGGCAGCGGT GTACTGGCAG CTGGACCTCC TGTGCTGCTC CCATGGATGC TCCGCCTCTT GAAGCGTTTG TATGCGACTT CATCGGCTAC GTTGTGTCCC TGTGAAGAAA AATAAAAAAA  CAGTGGGCAT GAGAAATTTT ACATTTTATA AATTTTATAC TTTGGCAAAA GTAATCGTCA CTCCAAAGCT GACAGCAAGT CCTAGAATAA ACTTTTGGAG AGCTGTTTCC TCTTGGAAAT  TTCACAATAA AATGTCCGTG TCTCTGCGAA TTTAAAAAGT CTCCCAAGAA ATTTTATTAG ACATTTCTTC ATAACTTTTG ACCTGGTATA ACATAGTATG ACATGTTTAA GAACCGTGAC  TTTTGAATTT AGCACAGCTT TTAGAAACTT TTGGGTTTTT TTCTAAGGCA ATGAGTTTCC TGTTTGTAGG GATTTTTTCC CCTCGTTAAC TTCACTTTAC TTTCATCCTC GAGTCCGCCC 
AGACTTTTCT GCAGGATTCC TAACTCCCCC CCGCCTCCAA 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGCTCTCGGAGGTTATCCCACCAAGTCCTCCAAAGCCAGAATAAAAAGGCTTAGGGTCCTGGTGAGCATGACAGTCGGTGTGGGCTGTTTGTTCCTCCTGCAGACGCACCTGGTG
AAGCCCAGAAAACAGAGGGACTTTTATTCGTTTGAGGTGAAAGACGCAAAGGGGAGGACGGTATCCCTGGAGAAGTACCGAGGAAAA
GTACGTCCACATCATCACCAGGCGTCTTAAGTT
TGGGGATAAATCTCTGCAAATCTTCATTTGGAAACGGAGATTACGTTTTTCGTCTTTATTTCCTACTTTCTTGTCATTACATTCTGTGCAGAGTTTTATTATAACACTTGCTCCATGGTT
TTTGTCCTGTTCAGGCATCGCTGGTTGTAAACGTGGCGAGTCACTGCCAGCACACGGAGGCGAGCTACAAGTCTCTGCAGGACCTGCACCGGGAGCTGGGCACGTCTCACTTCAACGTCC
TGGCCTTCCCCTGCGGCCAGTTCGGGGACACGGAGCCCGGGTTCAGCCGGGACATTGAGGCCTTCGCCAAGTCCACGTACGGCGTGACGTTCCCCTTCTTCAGCAAGATCAAAATCCTGG
GCACGGAGGCTGAGCCTGCCTTCAGGTTCCTCACAG
GTCAGCAGGAAAACTTCATGTCAGCAGTTGCTGACTTTAATTGTTTACTTGTCCGTTTTTTTTTCAGGGTGTAATGGTTATATA
ATTAATATTACGCTTGAATTTAGTGTGGATTTCTTCTTTAACCCACTTAGGATCAAAAAGGATAAAATCAATGCAGACATTGAGGCAGATATTTAAATAATGAAAGAGTTCTGAAGGTTC
TTGATCGAGTTTTACCCAGAAAAGACTGGCTGGTTAACTTTTTCTTATGATGGGTAACTTTTAAAACATAAAAAGGATTTAGAAAGATTTAGACAACAACACTAATATTTAGATGCATGT
CAGCTTTAAAGTTGAACCCTTTTCTAGACAGCAACAATCTTCCAGCAAAATTCTGCCTGGATGTTTTACCACTGCAAGTCAATTTTATTGACTTGTTTGCTGGCAGAGACTCAGGCTCTT
CAGTGAAGTACACACGTTTTAGGGTTGAAACTGAAGTGAATATTTATAGGAAGAAAATCCAAGAAGGCTATTATAAACCTGATAGAATTAGTTCGTTGTTTTGAGATCATTGTCCTGTTA
GAACACCATAAAGAAGAAGGTAAGTAAGAAATAAAGCTCTGTTTCAACTAGCTATTCATGTGTTTTTCAAAGAAAAGATTTATGGTGGTAGGAGAACCAGCTATGTCCAAACAATAACAA
AGAAGTTATTGTTTGGAGAAGCTAAGATTAGGCTTTCAGACCTAGTCGGCACCGTACAAACTGTTAAACATGGCATTGAAAGCATCATCATGATCTTTTCTGCTGCCAGTGGTAATTGAA
TGGCATATTGCACAAAATGGATGAAATCATGATGATCCAATATTAAATGAATGACATTCATATCAATGATGAGTGTTCAAAGGTTCTCAGTAAACGTGTGTATTGTTTTACCAGAAAAGC
TCAACACACATTTAAAGAGATAAAAAAAGCTACTTACAAATATGGAAATGCTCTTATTTTTGCATAGTTACATTGTTAGGAAATTAAATATTGTTGTTGCGCAACACCTCCCCCCCCTTC
TCTCTCACTCTACTTCCTCTTCTCAGAGGAGGGAGATGTGCAGCCAGCTCTCCATCTAACGGGTAATTTGAGTTTTCTAAATCTGATGGGATTTTACCCTGTTCAGAACTGAGTAAACTC
TGTTTAAGCTGGCATCGAGAAAGACTAGCCTGGTTTCTAACGACCTCCCCCTCCAGATGTCCCACCCTTTTTCACCCTGTGAATTAGCCAGATTGAGTAGCTTGCAACCAACTAGCTTCA
CAGAGCACACCTGTTAACGGTCGCTCTTTCTCTTTATTACAACTTGCACTTGTTACTGAACCAGGTTGGTTTTAGTGACTCGGGCGAGTCCCAAGGGTGTTGTTTTAGTTTTGGCTAAAA
GCAACCTATAAAACATTTCTACTTTTTCCTCCCAGAATCAAACTTCATAGCTATTTTACAACCATCAAAGAACTTTAAGGTGACTCATTAATTGAATGTCCACAACATCTTTTAGATTTT
CTTAATGCTAATTATTTTATTAGTAAGGCAATTTTGCAAGGGTCAGTACAGCTTAATTCACTAGCAGAAATAATCAAATAAGTAAAATCAATACTCTAGCCTATCTTTCCCTAATGCTGA
CACTGAGAACTAAAAAAGGGAAACTTTGAGAGAGACGGACAGAGTTTGGCATTTTGAACTCCAGAACTGGCCTGATGATGAAGAAGGTGTTGCAGCAGCAGGAGGTTCCCAGTACAGGAA
GAGTACTGACTTAGAGCAGCAGGTCTCGGGCATCAGGGTGACTTCCTCATGCGCGTAGCGGTCCTCAGCTTCTTGTCTTGCAGCTCTGTAGCTCCCTTCTCCTCGTCTCACGATCTTTCT
GGTCCCACAGAAGGAACACACCAGTTCTTCCTCTTTGCCTTTGTTCTTTGCCTTTGTCTTTATCTTCATCTTTGCCTTGGTCTTTGTCTTTGGGGGTCTAAACCCAGCTGTTGAGAGAAG
TGCGATTTGAAGCCACATGTTGCGGGGCTAACGGGTTGGTCCCCATGTGCAGAACAGTCTTCGGTTCTGTGGCCCCGGCTCTTCTTCAGCTGCAGAGTTCTTTGTCCATCTCCGTCTTGG
CTCGAAGCTGCCTGAAGGATCCAGCCAAAGATTCCTCTGTTGCACCCACCTTATAAAGGGTTTATCCACCTTTTGGTGCGTTTGCATTGGCTAGCTTTGTTGCTGTGCTTGTCTCATTGG
CTGACTGCTTGGACAGATGATCTCATCTCCATCACCTTGGAGACCTTATGACCGGATCTCTGTTCCAATGTCCCCAAGTTGCTCAACAGTTCCTCCTACCTCTGTTTCCTGCCCAACCTT
TTCTTAGGCAAGTTGAAGTTTAGCAATAAGGCCTTGTCTTCTCCGCTCTCCTATCAGTTCCCCTTTTCCCCTGACCTTTCACCTACCATCTACCTTCAACACAACATCAGTGACCTTTAA
TTACAGTTACAACATTTTACATCTTTTCAAGTTCAATGTCAAAATCACATTTATAACCTTTTAGTTTCTGTGATTTAACATTCACTTATAATGTTATAATAACCATAACTTATTAGTTAC
TCTTATTATAATCATAATGTGAGTTATTACAGACACTTCTGACAAGAAACCAAGAATACTCATTATTCTAATTATCTGATACCATGTTACAGTTTCTTGTTTTACCTTTAAGTACTTCCA
CAAGTGTAAGAGTAAGTGTAAATATTCTTATAATCAAACCAACATCAACCACTGGTTAAACCAATATTAATTATTGGCATAATTATAAGTCATTATTTTAAATATTTTACTCTGGGTTTT
ATCCAATCTCTCAAAATGTTTAGATTTTATTCTTTAAAAACCTTTAATGCTTTAAAATAAGGAATGGTCTGAATTATTTTTAGCCTGATGCAAGATAGAAACTTCCCCTTTTCTTCAGAA
AACCAGCTCTTCCTGTTTCATGACTCTCTTTCTGCCTGACTATGATTTTTTATGATTAAATAGAAAAAAGTAGAATTAAAGCAAAGTTTGCAGGACACAATAACAACACACACAACCAGA
TTCATTTTATTACAGTCTGACTCTATTGTTGGGTCTTGATGTCACCTATGTCATTAATTTTAMGGTAATTTTATTTATTATTACTATTAAACTAAAATCTCCAGCATGGGGAAGTGGGAT
GAGCTCGACTTTTCTCGACAATATAGTTGTTGTATTGCTGTCTAGGGATGTCATTAGAATAAAAAAAATTAATCCACTCAAACTGTACTTTTTTATTTTTTTTCTAGATTCTGTGCAGAA
AATACCAAAGTGGAATTTTTGGAAGTTTCTCGTGAATCAGGAAGGAAAAGTGATCCGGTTCTGGAGAACAGACGAATCCATGGAGAGCGTCCGAAAAGAGGTCACAGCACTGGTTCGAGA
AATCATCATAAGGAAACGCGGGGAGCTATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGCTCTCGGAGGTTATCCCACCAAGTCCTCCAAAGCCAGAATAAAAAGGCTTAGGGTCCTGGTGAGCATGACAGTCGGTGTGGGCTGTTTGTTCCTCCTGCAGACGCACCTGGTG
AAGCCCAGAAAACAGAGGGACTTTTATTCGTTTGAGGTGAAAGACGCAAAGGGGAGGACGGTATCCCTGGAGAAGTACCGAGGAAAA
GCATCGCTGGTTGTAAACGTGGCGAGTCACTGC
CAGCACACGGAGGCGAGCTACAAGTCTCTGCAGGACCTGCACCGGGAGCTGGGCACGTCTCACTTCAACGTCCTGGCCTTCCCCTGCGGCCAGTTCGGGGACACGGAGCCCGGGTTCAGC
CGGGACATTGAGGCCTTCGCCAAGTCCACGTACGGCGTGACGTTCCCCTTCTTCAGCAAGATCAAAATCCTGGGCACGGAGGCTGAGCCTGCCTTCAGGTTCCTCACAG
ATTCTGTGCAG
AAAATACCAAAGTGGAATTTTTGGAAGTTTCTCGTGAATCAGGAAGGAAAAGTGATCCGGTTCTGGAGAACAGACGAATCCATGGAGAGCGTCCGAAAAGAGGTCACAGCACTGGTTCGA
GAAATCATCATAAGGAAACGCGGGGAGCTATGA

Retrieve as FASTA