Entry information : PretGPx05
Entry ID 13803
Creation 2016-06-23 (Harold Duruflé)
Last sequence changes 2016-06-27 (Harold Duruflé)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-06-27 (Harold Duruflé)
Peroxidase information: PretGPx05
Name PretGPx05
Class Animal glutathione peroxidase    [Orthogroup: Gpx1003]
Taxonomy Eukaryota Metazoa Chordata Actinopterygii Poeciliidae Poecilia
Organism Poecilia reticulata (guppy)    [TaxId: 8081 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PretGPx05
start..stop
S start..stop
DrGPx02-C 315 1e-111 5..184 7..186
DrGPx02-B 310 8e-110 4..187 7..190
PretGPx06 304 3e-107 4..186 7..189
BtGPx01 265 1e-91 6..188 20..203
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..216 216 N° 2 744..1094 351  
join(1..216,744..1094)


exon

Literature and cross-references PretGPx05
Cluster/Prediction ref. Genebank:   103465223
Protein sequence: PretGPx05
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   188
PWM (Da):   %s   21053.98  
PI (pH):   %s   8.21
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASKFYSLTAKLLTGEIFNFSSLQGKVVLIENVASL*GTTARDYTQMNELHEKYSGKGLVILGVPCNQFGHQENCKNEEILLSLKHVRPGNGFEPKFQLLEKVDVNGKDANPLFVFLKEKLPFPSDEPSSLMTDPKLIIWSPVSRNDVAWNFEKFLIGPDGAPFKRYSRRFLTSDIEEDIKKLLRQAT*

Retrieve as FASTA  
Remarks
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTTAGAAAAT TAAACTATGA ACGTTGTTGT TAGAGTTGGC CCATTTGCGT GAAAATCTTT ACAACAACGG TTTACGCCAT TTTGTAACCT TCCACCATTA GGGCGCGTAT TTTATGAAAA  ACGGTCTAAT ATCAGGCGGG GTTAGGGCTC TTAATTCTCC TAATTTAAGA GAAACGCACT TAGACCGGTG TACGCCAGAG TAGTAAACAC GCGACCCTCT TAACATCGAA GAGTAGGCTG  AGCTGAGCTC TTTACTTTTA CTGCGACCCT CCTGTCATTT CTTGATCAAA CTGTTTTAAA TCATTCCTAC CGTCAGCGAG ACTCTCACAA ACAAAATGTA AGGAAAAAAA AACAAAACAA  AAATAAATTT CAGAATAAAA ACATTACAAA TTAGAAAATC AAAAACAAGA AATATCCCAC AATTTTATTT CACAATTATT TTGTCTTAAA TAACAGTAAT ACATGGCAGT ATCATTTCGA  AAGGGAGCTC AGAAAGCACA AAACACACAA GAGTGATGAC CTTTTAAGTA AAATTAGATG ATCAAGGACT AATTTTATTA TAATTATTAT TATTGTTGGC TCAGCTTTTA AGCCTTTCTT  AATTTGGAGA AAGAAATGTC TTTTTAAAGA ATGATTTATT TCTTTCCCTT TTTTTTGGTA GAAGGGATGA AGTCACATGA GGGTTTACTG AACCACCTGA CTGACCGTCA TGTGAGATGT  TGCAGTCATG CTGCTTGAGA TGCTGCTGAT GAAAGGAGAT GTAGGGATGG GATGTGGAAG CCAGAAAAGC CCATGCAGTT CAGAGCTTTT CCACACTGCT TTTCGGCTGC ACACACAACA  GGTTTTTTTC AGGGGACATA CGCCTATTCT TTTGAAGCGG CGAGTCTTCA TTGAAATGCC AGGTGTTATT TGTAATGCAG TTTGTTTCTC TGAAACGGGC CTTCTAACTT TCTCTAAAAA  TCTTCAAGAG GTTATGATAT CAAACTTTGA CATAATTCGT GGACATCATT CACTCATATT ACATCCTGCT GAAATAATGT TGCATGTAGG AAAGTCTTGC TTTGTGCAGC AACAACAAAA  AAAATCTGTG ACTTAGGGCA AAACGCAACA AACATTAAAC AAGAATACTA AAACTTAGCA TGTTTTAATA TAGCCTGTAT AGGTTTGTTT ATTTAAATTT GACCTTTGTC AGTTAAAATG  TCAGATATCC TCATGTACCA CAGTAATTAT GTATGTATAA GTATATGTTT TTTTTTCACT ATGAAGCGTA CATTATTTTT CAGTAACTTC TAATCAGAGG GTGACCAAGA CAAACACAGA  TTTCTATGAT ATAGCGTAAT TTTCACATAA AACCTAAAAT TTACACACTA AATGGAGTAT GTAGTGTTTG TCAGCATGCT AGTGATAACC CGCATACTTT AAGCAAAAAG CTACTGGGTG  AAAACTGTAT TGGCAACACA AGCTAATGTA TTTTTCTCAA TTTTCTTATT CGAGGCATAC ATATTCTAAA GGAATATGTT GAACAACACA TATTTTACAG AATAATGACT ACAATATGTC  CGAAATACTA GCAACGGTCA TTGAACTACA CTTAGATATT CTGTAAGTGC AGCAGCCTTA TTGGGGATAT AAAACGCAGA ATATGGCAAC TTCTTTGTTG TTTGTCTGAC TGAGAATTAG  GGGAGAAAAA AACTAAGAAA CTTGTACGTA AGGGTACAAG ACACCTCAAC ATTTATCTAA CCCCATTTGT TCCCTCGGCC CCCAAGTCAG GTGTCTTCTT TCTAAACGAA AGCGTCTATC  TTGAGTTCGC CAACTGTTGA TGGGGTGAAC TATCTTGATT GCATAAACGA AACGTAAGCC TACTGACGGT ATAGGCGGGT AATTGTCTCG ACAAGGGAAA ACAGACTCTT TGACAGTTTA 
AGAACCAGGG AGCGGGCGAA GGAAGCGCAG AAAACAGCGC ACTTGACTTG GGTTACGTCT TTGGGAGGAA AACCTGAATA 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCACCCAACA GCTGACCCTG GCCCAATTAT GTCCAGCAAT AAACCAGGTT CCAACTTGTA ATTCACCAGG GAGACATCCG TGGGGCCTTC TCTACTCCCT CTGTGGTTTC TCTAGATGTT  GGCATCACCT GTGCTCTCCT GTGTCTGATA GCTGTGTTGT TTTGTTTTTA CTACATGAAG ACGTCCTCTG AAACCAGGTG TAAGGGGGGT GTCGGATGAA ATGTAAAAGA TGCAATGTTT  ACGGCTTCAT CGGCTGCATG TAAAGCACGG TTGTGGTGTG ATGTGAGGAC CAATAAAAGT TTTTATTATC CAAACTTTGT CTTTTTAATT GTCCCCCAAA CCTTATGCTC TATGCCATCG  AAGCATCTAT AAGTTTCTAT TATCTTCCTT TTACTATTTG AATACTCTTT AGCAAGTAGA ATAAGCTAAA TTAAAAACAT TTTGCAAAAT GACTATTATA TACTCCGTGG TCTCTACTCT  TGCACACTGT GGCAGATCAT AGTCCATTTT GCCACCAGAC AGCAGGAGTG GTTAGTAATT ATGTTGCATC ACTTGCAACA ACAGGTTATG TTGCAACACA GATGTTTTCT GTTCAGTCTC  ACCCGGTTGT CCATAATCAC AGTGGAGATT TAAATTCGGG GTGTGGGTCT GCTTGCTGTA GTGTTAGATT TGAGATGTTT TTGATTGTGA GTGTTGTGGA GATTTATAGT GCCTTCCTAA  AGTGGAAGGT AAACGATACA TGAGTTTTTC CAGTTTTACA ACTTGAGGTC TTTGGGGTTA TGTATCAAAC CACATTTGCA CATCCAGAGA AAACAGTTTA AGCTCAGTCA AATGACATGG  AAAGCATTTT TATTTCGAGT CTTGCCACAG GTTCTCAGAG GGTTTTTGTT CTGGACTTGT CTCGTGTGTC TGCAGCTTCT CCAGTTACTA TAGGGGTTTT AGCTGCCTAT CTGATTAACG 
CTCGCCTTGC AGGCACCAAT CTGCTGAGGT GTGTGGCCAC A 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCGAAATTTTACAGCCTGACGGCTAAACTGTTGACAGGAGAAATATTTAACTTCTCCTCGCTTCAGGGAAAAGTCGTCCTTATTGAGAATGTCGCGTCTCTCTGAGGCACGACC
GCCAGGGATTACACCCAGATGAACGAGCTCCACGAGAAGTACTCCGGTAAGGGGCTCGTTATCCTGGGAGTGCCCTGCAACCAGTTCGGCCATCAG
GTGAGGAAACTCACTCTTACTATG
CTGTTTACCCCCCCCCCCCCCTCCGGGTTTGTACAGTTAGTTTCTAAGTTTTTATTTTCCCTAATTTGCAGTTCATCATGAAAAAGCTTTTGCCTAAAAATTGTAATTTAAATTGAAGAG
ATGAGGATATTAGTTTGTTTGATTTATGTGGTTAAAAATGGTCCTTTGCATCTGTAGTTTCAATTTTGAGGGATTTTTATTTTTGAAGAGGAAATTGTGGTTTATTTAAAGTTCCACCTA
ACAACCAAATAAATATTCATTATACTTCTATTTTTTTCTTCTTTGTTTTTTGGTACTTTAACGCATTAAACCACATAGTTTAACGACATTAAGCTATGCATTAAACAACTTAGAAATGGT
TCCTATAAGTTGCAAATAGTCGTAAAAGATTTCACAGAAAAGAGGAAGTTCGGTTTTCTTCGCTTAGTTCTTCCTGATCTAGATAAGAGGCAACATGAGTAAGACCGCCATAGTTAATGT
CCGTATTAATGATCAACCCGCAGGAGAACTGCAAGAATGAAGAAATCCTCCTGTCCCTGAAGCATGTCCGTCCAGGAAACGGCTTTGAGCCAAAGTTTCAGCTCCTGGAGAAGGTGGATG
TCAATGGGAAGGACGCCAACCCCCTGTTTGTGTTCCTGAAAGAAAAGCTCCCATTCCCCAGCGACGAGCCTTCATCCCTGATGACCGACCCCAAGCTGATCATCTGGAGCCCGGTGAGCC
GGAACGACGTGGCCTGGAACTTCGAGAAGTTCCTCATTGGGCCAGACGGGGCGCCCTTTAAGCGCTACAGCAGGAGGTTCCTCACCAGCGACATCGAGGAGGACATCAAGAAGCTCCTCA
GGCAGGCGACCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCGAAATTTTACAGCCTGACGGCTAAACTGTTGACAGGAGAAATATTTAACTTCTCCTCGCTTCAGGGAAAAGTCGTCCTTATTGAGAATGTCGCGTCTCTCTGAGGCACGACC
GCCAGGGATTACACCCAGATGAACGAGCTCCACGAGAAGTACTCCGGTAAGGGGCTCGTTATCCTGGGAGTGCCCTGCAACCAGTTCGGCCATCAG
GAGAACTGCAAGAATGAAGAAATC
CTCCTGTCCCTGAAGCATGTCCGTCCAGGAAACGGCTTTGAGCCAAAGTTTCAGCTCCTGGAGAAGGTGGATGTCAATGGGAAGGACGCCAACCCCCTGTTTGTGTTCCTGAAAGAAAAG
CTCCCATTCCCCAGCGACGAGCCTTCATCCCTGATGACCGACCCCAAGCTGATCATCTGGAGCCCGGTGAGCCGGAACGACGTGGCCTGGAACTTCGAGAAGTTCCTCATTGGGCCAGAC
GGGGCGCCCTTTAAGCGCTACAGCAGGAGGTTCCTCACCAGCGACATCGAGGAGGACATCAAGAAGCTCCTCAGGCAGGCGACCTAA

Retrieve as FASTA