Entry information : PretGPx06
Entry ID 13804
Creation 2016-06-23 (Harold Duruflé)
Last sequence changes 2016-06-27 (Harold Duruflé)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-06-27 (Harold Duruflé)
Peroxidase information: PretGPx06
Name PretGPx06
Class Animal glutathione peroxidase    [Orthogroup: Gpx1003]
Taxonomy Eukaryota Metazoa Chordata Actinopterygii Poeciliidae Poecilia
Organism Poecilia reticulata (guppy)    [TaxId: 8081 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PretGPx06
start..stop
S start..stop
DrGPx02-B 322 2e-114 1..191 1..191
PretGPx05 304 3e-107 7..189 4..186
DrGPx02-C 302 9e-107 1..187 1..186
SscGPx01 265 9e-92 6..189 17..201
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..225 225 N° 2 583..933 351  
join(1..225,583..933)


exon

Literature and cross-references PretGPx06
Cluster/Prediction ref. Genebank:   103464545
Protein sequence: PretGPx06
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   191
PWM (Da):   %s   21345.98  
PI (pH):   %s   7.06
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAGNIKRFYDLTAKLLSGESFSFSSLKGKVVLIENVASL*GTTVRDYTQMNELHSRFSAEGLVILGVPCNQFGHQENSRNDEILRSLKHVRPGNGFEPNFQLLEKVDVNGSDAHPLFVYLKEKLPVPSDNAVSLMNDPKFIIWSPVCRSDISWNFEKFLIGADGEPHKRYSRNFLTSDLEGDIKELLKRIK*

Retrieve as FASTA  
Remarks
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGGAGGCCTG AAGCGGGTCG GCTACTCACA GCGCCCGGTC CAGAAGCTCC TGCTTCTCCT GCAGGTCCTT CTTCAGACTC TCAACCTCCA CCTTCAGCTC AATGTTCTGC AGGACAAACA  GGAAGAACGA TGAGAAACGC CTGACCACTT CCTGCTCACA TCCTGACCAC TTCCTGCTCA CATCCTGACC ACTTCCTGTT TACTTCCTGC TCACATCCTG ACCACTTCCT Gnnnnnnnnn  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnACCAGA ACCAGAACCA GAACCAGAAC CAGAACCAGC  ACCAGAACCG GAACAAGCAC CAGAACCAGA ACCAGCACCA GAACCAGCAC CAGAACCAGC ACCAGCATTC TCTCCTCTGG GTTTGTGTTT GTTTGGGTCT AATCTTGGCT CCTCCACCTG  CTGCGTCTGT AACAACATCC AGCAGCGCCT CCACTTTTAG CCCCTCGCTC CGCCTGCAGC AACAAACCGG ACCGGACCGG CCCGGCCCAG CAGCTCTGCT CACATGCAGC AGGCGCTGAC  CCACTGACAC CCAGACACAG GTGTCCGGTT CAGAACCAGA GCAGGGCTAA AAATGGAGCA GGGCAGAATG TGGGTCAGTG GGCTGCAGGC GCACAAAATG AAAAGATTAT TTTTAATATT  TTACAAAGAA ACGACGAGTT TTTACTGTTT AACCTTCTGA TTTTATTCTC CACGGATCTG AGTGACGTTG GTCTCACAGC AAACTGGTGC AAATGGAAAC ATGGAATCAT CAATAATCCA  CCAGTTATTA CACTCATAAT AATGACGGCA CTATCAGTAC AGGTAGAAAA GGACATTTCT GTCCAAAATG TAGAAACTCT GACATTCATT TCAGACGTTT TCTAGAAAAC TCACATTTCT  CCAACAAGTT CGAAATTTTG GAATAATTCT CAGAAATTTG AAGGAAAAAT AAAAAAAAAT TGGAAAATTT CAAGAAGTTG AAAATGTTGA CTTTTGAAAC TCAGAAATGT TTGATTGACT 
TTATTTTTTC CGTCTCCAAC GGCGTCATGA GACATCATGA TGATAACAAC AACACCATAT TCAACATATT TAATTTAAAC 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TAGAAAATAA ACCGATTATT GGAGTTTCTG GGGTTTTATT CGGTGCGGTA AAAGCAGGAA AGACCAACTG TGTGTCGTTT TGTGAGGCTG GTTTTCAGGC CTGGTTTCAG ATTTCAGGCC  GAAACATTTC GACTTTAACT TCCCGAAAGC AGCCGATCGG TTTCATCAAA CATGCTTGAG GAAATTTAGC CGCCGTGTTG GACGTGATTT TGATGAAGCC CAGAGGTCCG AACACACGGC  CCTGTGGGAT CCCACCATCG TTTCAGCAGA AGCTGCTCAG GCGTCCGGCG GTTCAAATGC TTCTAACTTA ACATTTTGTT TTTAGTTTCG GTTATTAACA CGAAGGAGAA AATCTCTCAG  GGGTTCAAAC TCCAACCCCA GAAAAGTTCA ATAAATTACA GAAAAACATA AATTTTAAAT ATGTTTCAAC TTTAACCATT ATTTAATATT CTTAAAGCCT CATTAACTAT GGAATAATTA  AATCCACTGC ACTTTAAAAG CTTAAAGCTG CTTTTTTTTT CTGTGTTTAA TCAGCTGAAT AAAATTATTT CAGCCAAATA TTTGTTTTAA TTCATTCATT CTATGGATTT ATTGCATTAA  AACCTTTTCT TGTATGATTA ATTACACGTT TTTTATGTAA AAGTTCCAGT TGGAACTTTA GTAATTGCAT GTTTCTGGTA CACCTGTATG TCTGACGCAC AAGCTACATT CGCTAACAGG  CGATGAAGCC GCTTCTCCCC GACGCCGGAC TGGCTCGTTT AAATCATCGA TAAAGGTTCA GATAAAATCT GATTCATTAT TTACAGACTA TTAAATATTT TCATTAGTTT AAAATCTTCA  GGGTGAAGTT TTATTTCTGC TCTAGCCGTC AGGAAAAGAC GGATGGCGGT AAAAATACCT CGGCGCCTCG TTCTCTGTTC TCCAGCGAGG ATGATGAAAG GTCATGAACT TTGACCTGCA 
GCTCTTCGAC CTGGAGGCTT AGCGACTGTT TCTGCTGCAC C 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGGGAATATTAAGAGGTTCTACGACCTGACAGCAAAGCTGTTGTCCGGCGAATCCTTCAGTTTCTCCTCACTGAAGGGGAAAGTTGTTCTCATTGAGAATGTCGCGTCCCTCTGA
GGAACAACAGTCAGGGACTACACGCAGATGAACGAGCTTCACTCTCGCTTCTCCGCCGAGGGACTCGTTATCCTGGGTGTGCCCTGCAATCAGTTTGGACATCAG
GTAAGGGTTCCGTTT
TTGTAAATTAATTTCAATATTCATTTAAAAACCCTGCATTCAAAAAGTTTTTTTTTAAGCCAGTCAAGTGCACAAAAAGAATCCATCCATTATTATACCCTCTGTTTTCTATGTCTTATC
AGAAGGTCTTACCCACTATAAGTTGAATTTTTCAGATCAGTGTATCCTATAATTAAAATGGCTTCCACAAGCTTCCAAAATTCACCTAATTACATTATGAGGCAACCTATTTATTGAATT
GCTTTTATTACTCTTACTTTTTAATGCACACAGAACCGCTACTCAGTTTTCCCTATTGCATTTCAATGCATCTATAATTATGTTGATGTTTATGCATAACAGGAGAACTCAAGGAACGAT
GAAATCCTGAGATCCCTGAAGCACGTCCGTCCAGGGAATGGCTTTGAACCAAACTTTCAGCTCCTTGAAAAGGTGGATGTGAATGGCAGTGACGCCCACCCCCTGTTTGTCTATCTGAAG
GAGAAACTTCCAGTCCCCAGCGATAATGCTGTGTCTCTCATGAACGACCCAAAGTTCATCATCTGGAGCCCTGTGTGCAGGAGTGACATCTCCTGGAACTTTGAGAAGTTCCTGATTGGT
GCCGACGGTGAGCCACACAAGCGCTACAGCAGAAATTTTCTCACCAGTGATCTCGAGGGCGACATTAAAGAGTTGCTGAAGAGGATTAAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGGGAATATTAAGAGGTTCTACGACCTGACAGCAAAGCTGTTGTCCGGCGAATCCTTCAGTTTCTCCTCACTGAAGGGGAAAGTTGTTCTCATTGAGAATGTCGCGTCCCTCTGA
GGAACAACAGTCAGGGACTACACGCAGATGAACGAGCTTCACTCTCGCTTCTCCGCCGAGGGACTCGTTATCCTGGGTGTGCCCTGCAATCAGTTTGGACATCAG
GAGAACTCAAGGAAC
GATGAAATCCTGAGATCCCTGAAGCACGTCCGTCCAGGGAATGGCTTTGAACCAAACTTTCAGCTCCTTGAAAAGGTGGATGTGAATGGCAGTGACGCCCACCCCCTGTTTGTCTATCTG
AAGGAGAAACTTCCAGTCCCCAGCGATAATGCTGTGTCTCTCATGAACGACCCAAAGTTCATCATCTGGAGCCCTGTGTGCAGGAGTGACATCTCCTGGAACTTTGAGAAGTTCCTGATT
GGTGCCGACGGTGAGCCACACAAGCGCTACAGCAGAAATTTTCTCACCAGTGATCTCGAGGGCGACATTAAAGAGTTGCTGAAGAGGATTAAGTAA

Retrieve as FASTA