Entry information : PretGPx07
Entry ID 13805
Creation 2016-06-23 (Harold Duruflé)
Last sequence changes 2016-06-23 (Harold Duruflé)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-06-27 (Harold Duruflé)
Peroxidase information: PretGPx07
Name PretGPx07
Class Animal glutathione peroxidase    [Orthogroup: Gpx1007]
Taxonomy Eukaryota Metazoa Chordata Actinopterygii Poeciliidae Poecilia
Organism Poecilia reticulata (guppy)    [TaxId: 8081 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PretGPx07
start..stop
S start..stop
DrGPx04-A 304 2e-107 1..186 1..186
DrGPx04-B 286 2e-100 2..186 8..191
PretGPx02 283 6e-99 7..186 6..190
GgaGPx04 270 3e-94 17..186 1..170
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..51 51 N° 2 208..302 95 N° 3 388..532 145 N° 4 1725..1876 152
N° 5 2071..2095 25 N° 6 2248..2307 60 N° 7 2503..2535 33  
join(1..51,208..302,388..532,1725..1876,2071..2095,2248..2307,2503..2535)


exon

Literature and cross-references PretGPx07
Cluster/Prediction ref. Genebank:   103463715
Protein sequence: PretGPx07
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   186 (168)
PWM (Da):   %s   20812.59 (18938.6)  
PI (pH):   %s   8.94 (9.26) Peptide Signal:   %s   cut: 19 range:19-186
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLLTGCTVLLSVLLQAMSTPIEDWQRATSIYEFNATNIDGDLVSLEKYRGNVVIITNVASK*GKTPVNYSQLAKMHAKYAERGLRILAFPSNQFGNEPGNETQIKQFAQGYDAQFDMFSKIEVNGENAHPLWKWMKEQPNGKGTFGNSIKWNFTFLINREGQVVKRYGPLDDPSVVEKDLPKYL*

Retrieve as FASTA  
Remarks
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TACACCCAAC CATTCCTCGA CTAATGATGC CAAGCTTATC ATATTACATC TCCAATGCTT CCTTTCTTGT CTTTGCCTCT CCAAGAACCG ATTCATACGG TTAAGGTCCG TCCCAGACCA  GTGACGGTCT GTTCCGAAAC CCGCATTGCG GACAGGACAG ACCTGATGAA AAGGGCGTGC CAACCTTCTG GAAGGATCTC AAAATTGATA TGAATCTGGT TCACTGGAGA GAAGGAGACA  GGGTTTCCTG TGCACATCAA TAATTCTCTT AATCTGCACA AAATGATGCC TTTTTTTTTC TTAATAAATT TGCTCAGATC TAAATTGTAG TTTTTGTCTG GTCTGTGAGA TTTCTCGTTA  GTGTTGCTTT TTTCCACAAC CGGCTAGAGA TTAAAAGGGG CCCAAAGCAG AATTTTATTG GGGGTCAAAT TTACAGCTGA CGCCATCATC AGCATACTAA CATTTTTTAT TGGGCTTAAT  TGATTACAAA TTCTGCAGAT AAAACTGTTT AGTTGACATT ATTTATTAAA TAAATACCAC TGAGTGATAG CCATAGATGG CTCTTGGAAT AGGCAATATT GGCAGTTGCT CAGGACGGCA  ACTTCTGGAG GGGGCGCTAC CACAAGAACT AAAAAAAAAA CAATAAAAAA AACCCTTCCA AGAAATGACA ATAAATAAAT AATAGCAAGG AAATGTTGGC CGACTGTCTG TAGTAAAAAA  TTCAAACATA TTCACTGATA AGGAAATATT TAAATGTTTT GAGTTTCTTA AAGTTTTTTT TGTGTGTGTC TCATAATTAT AGTGGTGAAT AAATGCCAAC TTTTCTAATA TTATCCTTAG  GTTGCAATTT AGCTAAATAT GGCTGGCATA GTGTTTCTGA AGCTGGCATT GAGTTTGTAG CTTCTGCAAG AACAGTTTCA CCTTTTCATC TTTGGAATTG AATGAATGAA ATGAATCAGA  CCAGCTTTGT GTCACGTTCC TGCCCAAAAC AGCTGAACAA TAATCTACCA GGTTAGGGCG TGTTGGACAG TATTTCCTCT ATGAACAGGT CAAATGAAAA CAATTCTAGG TCAAAAGTAA  ATTAATGTCT TTTAAAAAGC TCATAAATAT TTTTGCTCCA GATCAGGTCC CAGTATGTTT TTTTAGTTTA CTTATGGCTA GGTTCTGACT TTCTGTGTAT AAATGGTTAA CGGGATGCCA  GTTGAATGTG GAGAGGAAAG AGTTTAAAAC TGCTTGACTA TATTTTAGAA AACAGTTAAT AGATTTTTAG AGCCTTACAG GATACCAGGA TATGAAACTG AAATCTTTGT GGGCATAACT  TCTATATTTA GAAACTACAC ATTTCCCATT TTGAATCTAG TGATTTGCAA CATATAAAAA TTGTGTACAT ATAGACTGCA ATGTAAGCTG TAACATTTTT ATAATCTATT TAATTCCACA  ATTAAAAAAA TTTGAATATC ATTTGTGAAA GATTTTGCCA TCCCAATTCA CTGTACTGTT ACTGATCATT GATATTGATA ATGTGAGGAG CTGCAGCTCT CTTGAGATTT TCCAAATATT  AACTTGAAAA ATCTGCTAAA AACTGCAGGT AAGAATTGCA CAGACTCGTG CAATTCTTAC CTTACATATG CGGGTGCCCC CTGCATATGT TTACTTTGAG TTATTAGAAT CACTTTACAT  TAATCCATTG TGCAGTTTTC TGACGGTCTT TTTATAAAAG TATTCAAGAA TGAATAAAGT TAAAGATGCC ACTGCTAACT CCAGGATTCA CAAGAGATGC ACACTGAAAA TGTCCAGTAA  TGCAAGTTTT CAGTGAGTTC CTGGCTGCAG TTACCCCACA TGCCTGCAGA TGGAGCCAGA GCTTCCCTTA TCAGCACCAA CCAGGCAGCA GCAGCGGGAT CTGCTCAGTA GGCAGCAGCA 
AGTGCAGCCA AGACGAGCGG ACTCTGCGCT GCTTCGTGAG GGAACACCGC ACTGATGAGG GGACCGTCGC TGAGAACCGT C 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGTAAACAGT TTGCACAGAC AGTGTACTTT GGTTCGGACA AATATTCAAA GTAATAAGAT TATACTTCAT GACACTCAAG TCAATACCCT CTAGCCCTCT GGGTCATGTT ACCTGCTGAT  AACCGCATCA TTTATAAACA CAGCTGCATG TGCCCTTTGT CATGTTGCAT AACTGAATCA CAGCATAAAA ATATTCATAC CCTCGTTTGT TTTCACATTG CAACCATCGC AGTTATATTT  GGTGGAATAA ATTGGAATGA AAAAAAGTTT TTCAAAGTCT CTTAAAAAAT ATAACAGTAT AACATTTCCA ATTGTATCCA TTTTTCTGTA TTAGTAAATT ACTGTTATGA AAAGGGTGAA  TATTACACAA ACTTGCTTGA ACATGGTGTA AGAAAAATCC TTCTAAATCT TTTGAACATG TTACCAAATC AAGGTCATTT AGCTTTTTAT TGAATAATGC TATTCTTGGC ACTCACGCTG  GAGATTTCCC ACATCAGCTT GTATAACGCT GCTTTAAAAT GTCTTGAAAA CACACGTTCT TTTGTTGTCT AGGCTTACGA TTTGGTTGCT TTTAAGCTCT GGCACTCAGA TGAACTTCTT  CAACCTGCAT GTGTTCCCCA AACTTGTCTG GTTTCCAGTT GGATTATCTT TTTTTTTTAA TTAAATCGTA TTACACAAAC AGTCTGAGTG TGTTTGCTCT GACCACCGCT CTTTGCCCCG  TGGGCCGCAC GCAGCTCAGT TTCCCCCCCA AGATTATCAA AAAAACTTTG AACTATGGAC TGCAGGACAC GTGCCCTTCT GATCTGGATT TATTTGTTTA GAACCAAGGA GTCACAGCTT  GTCATTTCTG TAAATCTGCG CCCGCCCCCT GGTAGATTGT GAACCACCTG GTGTGCGTTC TGTCTGTGTC AGTCTGAGGC TGTAAGCTTT AGTCACAGAT CACGAGGCGT AGGGAGCTGA 
TTGTTCTCTC TGTCTTCAGA GGAACAAAGT AAGAGGCAAT C 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCCTGACAGGGTGCACAGTGCTGCTCTCTGTCCTGCTGCAGGCGATGGTAAGATGGAATCAAATTAGGGCTTAAACGCTGGACCTTACTCTCATTTTTATTCATAACTTTGCTGTT
TTTTCAGTATTTGTATCCTCATTTACACATAATTCGAAGTAGAAATGCTATGCATCATTTTAACCCTCGTTTCCCCCCCCCCAACAGTCTACCCCCATTGAGGATTGGCAGAGAGCTACG
TCCATTTATGAATTTAACGCAACAAACATCGATGGGGATTTGGTGTCCCTTGAGAAGTACAG
GTAAGTCTGCTTGTGATCATTTCTCTTTTAATGTGACAGCTACAGTATCTTTCTTTAA
TGTGTCTTTTTTTCTGTGTGTCTTCAGAGGAAATGTTGTCATCATCACCAACGTTGCCTCTAAATGAGGTAAAACTCCTGTAAACTACTCTCAGCTTGCTAAGATGCACGCCAAGTACGC
TGAGAGAGGTTTACGCATCCTTGCCTTCCCGTCCAACCAGTTTGGGAACCAG
GTACGTTTAAATTAACTTCAATTGCATTTTATTGATGCAAAGCTGGACTACGACCTGAAAAAAAAGTT
TTTTATTCTAAAACGAATAGACTTTGATAACAGATTTTACAATTTACACGACCACAGACGTAGTGCAGATATAAATGTTTTCCCACTGGGAACAGGGGGGACATTTAGGCTTTTATGAAT
GTGTTTGTTTTGGATCTCTGCCCGTTAGTCAGCAGATTTATCCAGAAGCTGCCAACTTTATGAAGCCCTGTGTAATATAAGAATGTAAATAGAGAAAGATACCTTCAAGTCGGTGTAGGT
TCAGCCCAAGAAAGAGGTCATTATAATATTTTTGTGACTCTGGTCTGTTATGTGGCAGACAGTACCGGTCAGCAACTTGCACACAGTCTTCATTAGCGTCATTGTAGTTTATAGTTTGAT
AAAAAAACTTTTTTTTTTTTTTATCTGTTCTTTTTTTAAGAAAGCTGATACAAAATCAGCAGTTTCTGAACACATGACTTGGAAGCAAAAGTTTCAATTTATTTTGGACTTTATCTAGTC
CACCTTGTATCAAAATTATATAAACTTAAACACAAACACTAACCAACTGATATTTGATAAAAAAAATTCCAGGAAGTTGCAGTAAAACAAGCTTTTTATAGCAGCCAACAAGCATGATTT
TTTGATATTTAGCTTCTCTTTTTATTTGAATCTAGATATTGAAATTGATTTCAATTGGTTGGTTTCCTGGCCACAAATTTTCAACAAACACGCGGTGGTGTGTGCACGTGTGTGTGTGTG
CGCGCATTGATGTTATTGAGCTTTAGTCATGTTGAAACCAGTATGTCGTCATTGCCCCATTAGAACTCCCACTGTGTCCTCGTTTCAACCATCTAACTATCGATTAGAGTTGAAGTTGAA
GAAATTAACAATAGTCCACCAAACAGATCCTCAGCATGATGCCACCACCGCCATACTTCACGGCTGACACAGTGTTAAACACTTGCTGGCTGTTGTGGGCAGGGAACTCAAACTTTGTCT
TGAGTGCCTCTAAATGAGGTAAAACTCTTGCAAACTACTCTCAGTTTGCTAAGATGCACGCCAAGTACACTGAGAGAGGTTCACGCATCCTTACGCATCCAGTTAGTTTTTTTAAACTAA
CTGGTCTCCGTCATATCCGTTTGCTTTTTGTGTTTTACCTGCAGGAGCCGGGTAACGAGACTCAGATCAAGCAGTTCGCCCAGGGCTACGATGCTCAGTTTGACATGTTCAGTAAGATCG
AAGTGAACGGTGAGAACGCTCACCCGCTGTGGAAGTGGATGAAGGAGCAGCCCAATGGGAAGGGGACCTTTGGAAA
GTACGTTGATAAAAAAAAAAAAAAAACTTAATTAAGACACTAGT
CTGTAAAAGTCAGAGACCAGTTAATCACAGCTGCAGATGACAATGTATCATAACATCAACTTTAGCACCAGGGAATTATTTAAGCTGAAATGAAGGTCAATCAAATGAGAAATGATTGTT
CTGACATGCCTTTTATTTTCAATCCTGCAGCAGCATCAAGTGGAACTTCACTAAGGTAATCCCAACTAACAGTTTAGATTGTTTGACCTTGTTTCTCTTTTTTTTCTAAATTAATAAGAA
AACTACTTTACTACTTAACTGTTTGGTGTGTTTTTTTTAAAGCTCATGCTAAGTTACTTTGTGTTTTCTTTTCTTTTTTGTACCTAGTTTCTGATCAACAGGGAGGGGCAGGTGGTGAAA
AGATACGGACCCCTGGACGATCCAAGT
GTACGTACAAAATCCTTCCCTCCGTTACCGAATTGATCTGAGCTGTGTCAGACTTGCAGGAATCTTGACCAAACTTCCCTTTAAATCAACTCG
TGTTAAGTGGCAAACAATGAACAAACTAACTTAATTTCCGTCTCATTATTAATAGCAACTGGAAGATTCCCAGATGACATTTTACTCTTTCTTTGTTTCCAGGTGGTGGAGAAGGATCTT
CCCAAATACCTTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCCTGACAGGGTGCACAGTGCTGCTCTCTGTCCTGCTGCAGGCGATGTCTACCCCCATTGAGGATTGGCAGAGAGCTACGTCCATTTATGAATTTAACGCAACAAACATCGATGGG
GATTTGGTGTCCCTTGAGAAGTACAG
AGGAAATGTTGTCATCATCACCAACGTTGCCTCTAAATGAGGTAAAACTCCTGTAAACTACTCTCAGCTTGCTAAGATGCACGCCAAGTACGCT
GAGAGAGGTTTACGCATCCTTGCCTTCCCGTCCAACCAGTTTGGGAACCAG
GAGCCGGGTAACGAGACTCAGATCAAGCAGTTCGCCCAGGGCTACGATGCTCAGTTTGACATGTTCAGT
AAGATCGAAGTGAACGGTGAGAACGCTCACCCGCTGTGGAAGTGGATGAAGGAGCAGCCCAATGGGAAGGGGACCTTTGGAAA
CAGCATCAAGTGGAACTTCACTAAGTTTCTGATCAAC
AGGGAGGGGCAGGTGGTGAAAAGATACGGACCCCTGGACGATCCAAGT
GTGGTGGAGAAGGATCTTCCCAAATACCTTTAA

Retrieve as FASTA