Entry information : PretGPx08
Entry ID 13806
Creation 2016-06-23 (Harold Duruflé)
Last sequence changes 2016-06-23 (Harold Duruflé)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2016-06-27 (Harold Duruflé)
Peroxidase information: PretGPx08
Name PretGPx08
Class Animal glutathione peroxidase     [Orthogroup: Gpx1005]*
Taxonomy Eukaryota Metazoa Chordata Actinopterygii Poeciliidae Poecilia
Organism Poecilia reticulata (guppy)    [TaxId: 8081 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PretGPx08
start..stop
S start..stop
DrGPx07 253 8e-88 5..148 43..186
BtGPx07 223 6e-76 5..148 43..186
OarGPx07 222 8e-76 5..148 43..186
XlGPx07 222 9e-76 5..148 41..184
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..283 283 N° 2 2763..2926 164  
join(1..283,2763..2926)


exon

Literature and cross-references PretGPx08
Cluster/Prediction ref. Genebank:   103463138
Protein sequence: PretGPx08
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   148
PWM (Da):   %s   16689.6  
PI (pH):   %s   8.22
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVILRTQVSLVVNVASECGFTDQHYRDLQQLQRDFGPFHFNVLAFPCNQFGQQEPGSDKEIDSFVRTVYGVSFPLFSKIAVVGTGANNVYKHLAEVSGKEPDWNFWKFLIDVDGRAVDAWGPKVPVTQIRPKIADMVRQIILKKKEEL

Retrieve as FASTA  
Remarks
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TAAGCATAAA TGGAACTGTG TGTCACAATA AAGAGGAAAC AATGAACGGG AACAACTGAA AAACKGACCA GTTTATGAAT AATTCAGCAT AATTACTTTT AAAGAAGTGT CGGTTATATT  ATTCTACTGA GAAGTGGGAT ACTTCTAAAT GAAAAACAAA AATGATTTAG TGTGGGAAGC TGTTTTCCTA AATACACGTT TATTTTGAAG GCATAAGTAT GGAGCTAAAT TAGGACCATA  AAATTTGTTC AAAGAAAAAA AAAACnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn  nnnnnCATGA AAAAATTGGG TTAATTTTTC AGTCATATTT TAACTATAAT AAACGTCAGT TTCAAACTGA ATATGTAATT AGTAAGCTAA ATATTTAGCT TACAATGTGA ATATGTAGTT  CTGTGTTAAG TATTTCTGCT TTAAGAAAAA TATTTAGTTA ATATTTAGTC TAACTAGTAA ACTATTCAAG CTAAATATTT AGCTTCAAGC AAAAAAAAAA AAAATACCAT GCTAAATATT  TAGCTTATCA AGTAAATATT TAGTTCTGAA TTAAATATTT TGCTTTAAGC TAAATATTTA GCTTGCTAGG TAAATATTTA GTTTAATCAA TCTAAAAAAT AGCTAGCAAG CTAAACATTT  AGTTAAATAT GTAGCTGTCT GCAAACACCT TTCTAGCTAA AWATGTAGCT AGAAAGCTAY ATAGCTTTCT TGCTAACAAA ATTCTTAAGT CAATATCAAA AACTCAACAA ATATGTCAAA  TTTTACAAAA CAGCCGAGTA AATTATCGCT TCAGAATTTA TCTGGAAAAA TTAATTCAGA GTAAGCTAAG CATGCTAAAC ATTAGCAAAG TTAGCAAAAA CGCTTCAGCA CTAATAAAAA  AAATTTGCTC TGCTGATAGC ACAAATATGC CTACCTCTGC TAACAGTTTG TTTCCTTAGA TCTGAAGACT TCTGACCATT AAAAGCTTTG TCCAGAAACC ATTAAGCTGC ACATTTCAGT 
CAATTTTCAA TCAACAACTT TGGCATCACC GAGTTTCCGT AAGCTTCCTT AAGTGTTTAG TAGTGAYATT CGTAACTGAA 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTCTCCGATT CCTCCACGAA CTGAACACAA GTTTTACATT CCCAGTTTTA TTATCTATCC GCAGCAGCTT CGGCTACTTT CTGAGTGCAC TGATCCAACA CTCTTTAAAA AGATCTGATG  CTTTTAGGAA CATTTCTAAA CCAAAGAGCT CGTTTTTAAA TAAATTTCAC TGTGATTCCG AGTTTGTTTT ATGCTCTGCG TCATCACTGG TTGGTGGGAC TCGATTGCAG AGTCTTTAAT  TGAAGACTAC ATCAACAAAA CGGCAACATT TTCAATTCAG AAACCCTTTT TTCTGCTAAA TGAATAAATA AATGAGCTCA ACAAAAACAG ACATTTACTG TTTTTAATCT GTTATTTAAC  CACCAAATTA ACGCAAAGCC CTTTTATATC CATCCAGCAT TAGATTTAnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnGCTCAAC AAATGAGCTT TTTGAAACGG CTCATTTAAA AAACAAAACA AAACATGAAT TTATTTCCAA AAACAGTCGG GGTGTTTTTT  TAATACTTGT TTTTTAAGCA ACTGAGATTG AAATGGACGA ACAAAAACGC ACAAAATGCG GATCTTATGT AATGGACCCT TTTATTAAGG AGTAGAATGA TGTAAAATTG ACAGTTTTAA 
ACTTTCCATC ATCAGAAACA AACCTGGAGT GCTGCTTTGA T 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGATTCTGCGGACTCAGGTGTCCCTGGTGGTGAACGTCGCCAGCGAGTGCGGTTTCACCGACCAGCACTACCGAGACCTGCAGCAGCTGCAGCGGGACTTCGGCCCGTTTCACTTC
AACGTCCTGGCTTTTCCCTGCAACCAGTTCGGCCAGCAGGAGCCCGGCAGCGACAAGGAGATCGACAGCTTCGTGCGAACCGTGTACGGRGTCTCCTTCCCGCTGTTCAGCAAAATCGCC
GTGGTTGGAACAGGAGCCAACAATGTCTACAAACACCTGGCAG
GTGAGTCCCAAGTACCGATTCCAGGACATGATTTTTTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNGAAACAAAAATATTCTTGTTTTTTTCTAGAATATTTCTGAGATTCATCTCAACATTTCTGAGTTTTTGGCAGAAATTTGCTTTTGTTTTCCTCCAAT
GGCCCTACATGCCTGATTCAGTCCGACTGATTATCTCCAGTTGAACGATACCAAAGTAATCCTGATATAATAATTTAAACTGCTGTCAGTGCTGTATTTTTTTAGATTTAATATCTTTCT
GCTCCATTTTCCCGCTTGAGAAAAAAAAATMATGTAAAGTTAGAAACGTCCAGGTCATAAAAGAAAAGCTTTTTCATACTTCAAACTTAAGACTGAAAATAAAGTATAATATAAAAAGTA
TTGCTTCATTTTTAAAAATAAGTGTCGATTAATTTTGAAAAATGAAAGTGAAATCTTTGCGCACAAAATAAATACTTCCCATAAATACTTTTCTATTTGCTTAATTGTCAGAATAATAAA
TAAATGACTAAAATAATTGTTTATAACAACCAGCATCTCGTTTCTTTGGAATCTRAATATTTTCTGTTTTTCCTCGTTGCAGAGAAAAGCAGGMAATGTTTTAAAAGTCTCTTTCTGTGC
AGAGGTGTCCGGAAAAGAGCCTGACTGGAACTTCTGGAAGTTCCTCATCGACGTTGATGGCAGAGCGGTGGACGCCTGGGGGCCGAAGGTTCCCGTCACGCAGATCCGGCCGAAGATCGC
CGACATGGTGCGGCAGATAATCCTGAAGAAGAAGGAAGAGCTTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGATTCTGCGGACTCAGGTGTCCCTGGTGGTGAACGTCGCCAGCGAGTGCGGTTTCACCGACCAGCACTACCGAGACCTGCAGCAGCTGCAGCGGGACTTCGGCCCGTTTCACTTC
AACGTCCTGGCTTTTCCCTGCAACCAGTTCGGCCAGCAGGAGCCCGGCAGCGACAAGGAGATCGACAGCTTCGTGCGAACCGTGTACGGRGTCTCCTTCCCGCTGTTCAGCAAAATCGCC
GTGGTTGGAACAGGAGCCAACAATGTCTACAAACACCTGGCAG
AGGTGTCCGGAAAAGAGCCTGACTGGAACTTCTGGAAGTTCCTCATCGACGTTGATGGCAGAGCGGTGGACGCCTGG
GGGCCGAAGGTTCCCGTCACGCAGATCCGGCCGAAGATCGCCGACATGGTGCGGCAGATAATCCTGAAGAAGAAGGAAGAGCTTTAA

Retrieve as FASTA