Entry information : PretGPx09
Entry ID 13807
Creation 2016-06-23 (Harold Duruflé)
Last sequence changes 2016-06-23 (Harold Duruflé)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-06-27 (Harold Duruflé)
Peroxidase information: PretGPx09
Name PretGPx09
Class Animal glutathione peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Metazoa Chordata Actinopterygii Poeciliidae Poecilia
Organism Poecilia reticulata (guppy)    [TaxId: 8081 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PretGPx09
start..stop
S start..stop
XlGPx01 142 3e-45 1..134 1..138
DrGPx02-C 144 4e-45 1..134 49..186
MmGPx06 144 8e-45 1..134 82..215
CfaGPx01 143 2e-44 1..134 61..198
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..85 85 N° 2 1000..1130 131 N° 3 1229..1359 131 N° 4 1438..1495 58
join(1..85,1000..1130,1229..1359,1438..1495)


exon

Literature and cross-references PretGPx09
Cluster/Prediction ref. Genebank:   103481448
Protein sequence: PretGPx09
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   134
PWM (Da):   %s   15362.75  
PI (pH):   %s   4.56
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNALMEMFGNLNFTVLGFPCNQFGLQSPEVNEEMLNVLKYVRPGGGFVPKFPVFAKIEVNGLNEEPLFTYLDSLPFVNPLIGDIKKFYWSPICVNDIRWNFEKFLINSDGTPFKRYELHCPIEMVEKDIVDLL

Retrieve as FASTA  
Remarks
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CACATTTATA AACTACTACA ATGCACTGCT CCTTGTTAAA AGTATACTTA CGGTGGAAAA ATTAAAAGTC CTGCAGTTGG CCAGATACAC CTGGACGAGG CTGTGGAACT GCTTGCTCAC  CCTCTGCAGG CTGACAATGT GCTGCAACGG CAAGTAGGAC AAAATGTGTG GAACGAGAAC ATCCTCCCAA GGCAGGTCCA AGAGATGACA TCTGCAGGAA AACAAACCCT GTTACAGCTG  AACTTTGACT CTGCAAACGC TTAAACAAAA AAAAAAAAAC TCAACGAATA CGAGTAAACA CACAATGGGG TAATATAATG CATTAGCATT GAGTGCTGTT GCGTTTGCCC TGGCGCTGCT  GTATATGGTT AAAATTAATT GCCAGCTATA TATAAATGGC ACGAGCTGCG TTCCAGTGAC TGTTAGTTAA TATTCGTACG CTTCCGCTGT TAGCCGAAGA GCTAGTCTGC CGGGGCCACC  AACTCAGCAG TTTTTTTTTA GAGATATGAG CTCGTTTTAA AAGCCACTTA CGTCTGCCAT CTGCCTTCTT CGTCCATTGT GAACCAGCTG TGTAATACGC TGTTTTTCAG GACGAGCTGT  TCTTTACATT GTCACCTAAG GAGCGTATTT TGCCTTAGCA TCTTGGAAAG CGTTTGAGGA GTAACCTAAA CCAGAAGCTG CATTCACTGG TTGTCGGAAC AATTATTGTC AACAAAGAAA  AATGCGCAAA TAGTCTCACA GAAGATTACG GAACTTTGTA AAATTGTCAG ATTGAATACT GCCACTGAAA AAACACAACA TAATGGGGTA TCTGATTAGT CTGAGTTGCA ATTTAGTTTG  TAAATCATGT AGCCAGAGAA GCAAATGCAC CGAAATTATA GTCGTTTACA AAAGTAACGT GCTAATCCTT TCTGATGGAG TAATTTTGAA ATATTTTTTT AGTCAAATCC AGAATTTTTT  TGTCGTGTTT TATAGCAGTA ACCTGGGAAA TGCATCACTG GTCATAACAT TTACGGTGAA CACTTGAATG CGTCATGACT GATTTTTTTT TTGTATTCTA GAGATGAGGG GATTATAAGT  AGACTGATTT GTTACAGCTG TCTTTTTTTT TCTTTCAAAA AGCCACCTGA TGTTATGCTC ATTTCCCAAA TCAGGATGTT AAATATTATT TCTAACTTTT AAAATTCCCC CAAACATATT  TTATTCTACA CATCAAAAAT AGGTGCTTCC AGAGAAACTT ATATGTCCCT TTAGTGCTTT GAACGTCAAC AATTCAAACA TCACTGGCAC GACGAAGCAT CTTATAAAGC ACACACACAC  ACACACACAC ACACGCACAC GCACACACAC AGTTAGAGAA AGAAAAATGG CAAAAAAATT AATATCTTCA AAAACAAGTA TTTATTTACA TTTTCAGTAA TATGAAAGTA TCTACGATAA  AATTATGCCT TTTTCAATGT AACCACATTT GTTGATCATA ACTAAATATT TTTGACTCTC ATAAGTCAAA ATCACAATTC AAAATATATA TCAAAAGAAA TAACTGTTCT CTTAATCCCC  CAGTTCCAAA GATAAACAAG AGCTCTTTTA AGTTCAGCAG TTAGCTACTC AGCCAGTTCA CCTCTGTCCA GAGGAACAAT GAAGTCAATC ATGCAGAACA ACTGCTGACC CAACAAGTTA  TTTTTCAGTG AATGACAGCA GCCAGCAGAG TAGCTGAGTG AATGCTCACT CCTCAGTAAA CATAGTCCAT ATACAAGCCA GAGAACAAGA ATGGCGTACA AGTCGATATA TGATTTTTCC  GCTGAGACGC TGGAAGGAGA GGAAGTCCCA CTGAGCATTT ACAAAGGAAA GGTGCTGCTC ATTGTCAACG TTGCCACCTT CTGAGGGTCA ACGATTGAGG AGGTGATTCT TCAAGAACAT 
TGACTGCATA ATGTTCTACA TAGTGTACCC ACGTAGCCTT ACTGAAACCA TTATTTTCCA TGTTCTCTCA GTACCACCGA 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGACTTTAG GGAAACACTC CCTGATGGCA GAGTGATGAT CGCTCAGTAA ATGCATATGT GCACCTGAGC TGAATCTGAT TGGAAGAGGA ACATGTGTAG GAGCTTCAGT GCATTCTCTC  TGAGAACAAG TTCCCTTTCA GCCACTCGAG GAGTTTCCAT GTCACTGTCA TGCTTCTTGG AAATGGACTT GGAACTGCGA TTCAGAATCT AAATTAAAAT AAAGCATGAA ATTTAGAACT  TTGTTTTTGT TATTGTCGTC ATTGATGAAC CCTAGCTTAA AACCAACGTG ACTGAAAATT TTACTATCTT ATTATAGTAA TAAATAGTAT GTTGGGCGTA AAAATATAGC AGCTAAGCAC  AGCAGTAGTT ATGCCCTGCA AACAAGACTG GTGTTGATTT CTAAGAGTTG ACTAAGGATG TTGCTAAGGA AAAAGGTTCT GGCCTCTCAC CCCTTATATG TAGTACAAAA GGAGTCTTAC  TCCTTAAACT TTATGATATT TTATCACATT ATACAGCCAC AAATTTTAGT GTTTTTTTCT GTTAAGTGTA TATGTGCAAT ACAACACAAC CTTGTGCCTA CTTTTTTCAA ATATGCAAAT  TATACTTAGC TACTAAACAG TATAGATTTT ACAATGCCCA ATAAAACATA AAAAGCACAA TAGTTATAGT ACGCTATAAC GAAAGAACGT AAAAGGAGTG CGTTAAAAAA TCATAGCTTA  TCATCACAGA ATTGAAAGAA AAATCAAAAA TGGGTTTGAA AGTTTTAATG AAATTCTTAA AGTGTAGTGT GTATTTGTAT TTAGTCTCAT GAGCCAACTG CAGTTACTGC CACCATTGTA  TGCCACTTTG CATAATAAAC ACTGCCAACA CAATGCAAAA TAAAAATTAA CTCTGGACAA CAGATAACAG AAAATTGTAT ACTTGATAAA GACGTGGTTT TTAAAAATGT ATTTATTTAT 
TTTTTTATTA ATCACCTTTT CAGAGAAAAT GTTTGCAAAT T 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATGCACTAATGGAAATGTTTGGCAACCTGAATTTCACTGTGTTAGGTTTCCCCTGCAACCAGTTTGGTCTTCAGTCACCTGGTAAGTTTCTCCTCTTATTTAATTAAGCTAATATT
GCTTTTTCTTATTATGTTTATCAGGCAAAGATCGTTGGACTTATAGGGAAAAGTTATTTGCTTGCATTGTGTGCATACTGAACACTTGTTTTACTGGTCCCTCATGATAATAAAAAGCCC
TTGTTCAAAAGTAGAGTAAAAGGTGATTTGTTATCATATTATTTTTTCTTTTGAAGTGATAAATTGAAATTGTTATTTTTGATTATTAAACAGCATGCAATTTTGAAAACTAATAAAGAA
AGAAAATCCAATGCATAGGTTTAAATTTATCACAGTTATTCTCTTACACACAGGTTTGAAATTAAATCAAATATTTAATTAAAGGCAGAGTCTTTGGAAGGAAACCAACCAATTTAAATG
AACTCTACTAATTCAAAGGTTCATTAAACATCCAGCCAGGACCTTCCTGACAACTGCAAAATGTGGTTTCTCTGCATTTCGTTATGGGGAATTTAATCAAATATTAGTGGATGTATATGT
ATGTATTTGAACTTGGATATAAGATTTACAACCTTAGTGTATCAGAGAAAATTCAACGTGAATTCAAACTTGTGAATCCATTTTAGATCTTCAAAATTTGTTGAAGTTGTTTTTATTGTT
TCACTCTGTAAAAATAACAATTCAAATGCAACCATAAAAGCCTTTAAATTAATATAACATTCACGAGAATGAGAAGTGAACGGAAACGTCTGACTGGAACAAACATTTTTGAAGTACATT
TCCTGAAAGATAGTTGGCTTCTTCCAAATGTAACAGTCGGCACTTTTTGTAAGTCTATGATTAATGCCGCTTAAAAAAACTGTTTTTATTTGTAAGTGACATGTGCTAACACAGAAATAA
CTAAAGTACATAAATAATTTTACATGCATCTGTTTTTAGAGGTGAATGAAGAAATGCTCAATGTACTGAAGTATGTGAGACCTGGTGGTGGGTTTGTTCCAAAGTTTCCCGTCTTTGCCA
AGATCGAGGTGAATGGGTTGAACGAAGAACCTCTTTTTACATATCTAAAG
GTATGCTGCATTCTACAGAGATTTTAGATGTATACACTCAAAAGATTCAGAATCGTTCCTGTTAGCACAG
CTGTTTCGTCTCTTCTTGTTCTCCACAGGACTCGCTGCCATTTGTTAATCCTCTTATTGGCGATATAAAGAAGTTCTACTGGTCCCCAATATGTGTCAACGACATTAGATGGAATTTTGA
GAAGTTTCTTATTAATTCAGATGGCACCCCTTTCAAAAG
GTAAAGATCACATACAAAACCTCCAGGTAATTTAAGGCTGTTTTTTTTCTGTTACATGCCATCTACCTTGTTGTGTAGGTA
TGAACTTCACTGCCCCATTGAAATGGTGGAGAAAGACATAGTAGACCTTCTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATGCACTAATGGAAATGTTTGGCAACCTGAATTTCACTGTGTTAGGTTTCCCCTGCAACCAGTTTGGTCTTCAGTCACCTGAGGTGAATGAAGAAATGCTCAATGTACTGAAGTAT
GTGAGACCTGGTGGTGGGTTTGTTCCAAAGTTTCCCGTCTTTGCCAAGATCGAGGTGAATGGGTTGAACGAAGAACCTCTTTTTACATATCTAAAG
GACTCGCTGCCATTTGTTAATCCT
CTTATTGGCGATATAAAGAAGTTCTACTGGTCCCCAATATGTGTCAACGACATTAGATGGAATTTTGAGAAGTTTCTTATTAATTCAGATGGCACCCCTTTCAAAAG
GTATGAACTTCAC
TGCCCCATTGAAATGGTGGAGAAAGACATAGTAGACCTTCTCTGA

Retrieve as FASTA