Entry information : PretPOX02
Entry ID 13810
Creation 2016-06-27 (Harold Duruflé)
Last sequence changes 2016-06-27 (Harold Duruflé)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-06-28 (Harold Duruflé)
Peroxidase information: PretPOX02
Name PretPOX02
Class Non mammalian vertebrate peroxidase    [Orthogroup: POX001]
Taxonomy Eukaryota Metazoa Chordata Actinopterygii Poeciliidae Poecilia
Organism Poecilia reticulata (guppy)    [TaxId: 8081 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PretPOX02
start..stop
S start..stop
PretPOX04 357 4e-123 1..226 281..503
SiniPOX 270 2e-86 7..184 583..759
TrubPOX01 239 1e-74 7..167 582..739
OanEPO 202 3e-63 7..150 307..450
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..257 257 N° 2 340..560 221 N° 3 664..701 38 N° 4 793..951 159
N° 5 1116..1151 36  
join(1..257,340..560,664..701,793..951,1116..1151)


exon

Literature and cross-references PretPOX02
Cluster/Prediction ref. Genebank:   103461399
Protein sequence: PretPOX02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   236
PWM (Da):   %s   25933.95  
PI (pH):   %s   4.32
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MISITSGYNAWRRFCGLSQPRNQAELAQVMRNPTLAQKLLQLYGTPENIDVWLGGVAEPFVPGGRVGPLLSCLIATQFQRIRQGDRLWHEKPGVFTPQQRQALSAVTLSRIICDNTGITSVPSDAFSIVSNTNRMVQCSTLPRLNLLAWRETPSRLCDGSSAGCLESSDRNPTQTDELNNLDPLDLQDALDPEDPVNVRGPLDLQEPLDLQDPDVSLKFETNEILEDHSAPDAL*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATTTCTATCACTTCAGGCTACAATGCCTGGCGCAGGTTCTGTGGTCTGTCCCAGCCTCGTAACCAGGCAGAGCTGGCTCAAGTTATGAGGAATCCCACGCTGGCTCAGAAGCTCCTG
CAGCTCTACGGGACCCCCGAAAACATCGATGTGTGGCTTGGAGGAGTCGCAGAGCCATTTGTGCCTGGCGGCCGCGTGGGTCCTCTGCTCTCCTGCCTCATTGCAACTCAGTTCCAGAGG
ATTCGTCAGGGTGACAG
GTCAGTAAAGCAGAGTAGGACTAATGAAGTGTACAAAAATAAATCAAATGGAGTGATTTTCTAACATTCTGGAATATTTAAGACTGTGGCACGAGAAGCCCGG
TGTTTTCACGCCACAGCAGAGGCAGGCTCTGTCTGCTGTTACACTCTCCAGAATCATCTGTGACAATACCGGCATCACATCTGTGCCCAGCGATGCTTTCAGCATCGTCTCAAATACGAA
CCGCATGGTGCAGTGCTCCACTCTGCCTCGCCTGAATCTTTTAGCATGGAGGGAGACACCCTCCAGGCTCTGTGACTCCG
GTGAGAGCTTTTTCATCCTAAGGACCAGTCAGCTTACCTG
ATGTAGTGTAGCGTTCTCTTTTGTAATTGTGTATAAAATGTTTGGTTTTGTTTGATATTACAGGATCCTCTGCCGGTTGTTTAGAGTCCAGTGACAGAGAGGTCAGTTTAACCTTTACTA
CTGAAATCATGTCAAAGGAAATCTAGGATATTTAAAAATCTGAAGACTTATTTTGATCCTTGTGTTGAACAGAACCCAACCCAGACCGATGAACTGAACAATCTGGACCCTCTGGATCTC
CAGGATGCCTTAGACCCAGAGGACCCTGTAAATGTTCGTGGTCCTCTGGACCTCCAGGAACCACTGGATCTGCAAGATCCAGATGTTTCATTGAAATTTGAGACCAATGAG
GTAGTTGAT
TCTGAGTAGTAATTTCATAAAGTCTGCAGTTCATTTGTATATTTTTTGTCATTGCTTAGATTTGGTTGCTTTATGAAATTTGATTATTATGTGCAAACAATACTCTACTCATTTCATCTT
CTCAGCATTTTGACAAAATGTGTGTTTTTCTTCAGATCCTTGAAGACCATTCAGCCCCAGATGCCCTCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATTTCTATCACTTCAGGCTACAATGCCTGGCGCAGGTTCTGTGGTCTGTCCCAGCCTCGTAACCAGGCAGAGCTGGCTCAAGTTATGAGGAATCCCACGCTGGCTCAGAAGCTCCTG
CAGCTCTACGGGACCCCCGAAAACATCGATGTGTGGCTTGGAGGAGTCGCAGAGCCATTTGTGCCTGGCGGCCGCGTGGGTCCTCTGCTCTCCTGCCTCATTGCAACTCAGTTCCAGAGG
ATTCGTCAGGGTGACAG
ACTGTGGCACGAGAAGCCCGGTGTTTTCACGCCACAGCAGAGGCAGGCTCTGTCTGCTGTTACACTCTCCAGAATCATCTGTGACAATACCGGCATCACATCT
GTGCCCAGCGATGCTTTCAGCATCGTCTCAAATACGAACCGCATGGTGCAGTGCTCCACTCTGCCTCGCCTGAATCTTTTAGCATGGAGGGAGACACCCTCCAGGCTCTGTGACTCCG
GA
TCCTCTGCCGGTTGTTTAGAGTCCAGTGACAGAGAG
AACCCAACCCAGACCGATGAACTGAACAATCTGGACCCTCTGGATCTCCAGGATGCCTTAGACCCAGAGGACCCTGTAAATGTT
CGTGGTCCTCTGGACCTCCAGGAACCACTGGATCTGCAAGATCCAGATGTTTCATTGAAATTTGAGACCAATGAG
ATCCTTGAAGACCATTCAGCCCCAGATGCCCTCTAG

Retrieve as FASTA