Entry information : PretPOX03
Entry ID 13812
Creation 2016-06-27 (Harold Duruflé)
Last sequence changes 2016-06-27 (Harold Duruflé)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-06-28 (Harold Duruflé)
Peroxidase information: PretPOX03
Name PretPOX03
Class Non mammalian vertebrate peroxidase    [Orthogroup: POX001]
Taxonomy Eukaryota Metazoa Chordata Actinopterygii Poeciliidae Poecilia
Organism Poecilia reticulata (guppy)    [TaxId: 8081 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PretPOX03
start..stop
S start..stop
PretPOX01 364 2e-131 1..180 1..180
SiniPOX 310 1e-102 7..180 266..439
TrubPOX01 308 1e-101 7..180 265..438
DrPOX01 253 5e-81 1..180 262..439
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..15 15 N° 2 106..469 364 N° 3 1071..1231 161  
join(1..15,106..469,1071..1231)


exon

Literature and cross-references PretPOX03
Cluster/Prediction ref. Genebank:   103461588
Protein sequence: PretPOX03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   180
PWM (Da):   %s   20052.13  
PI (pH):   %s   7.87
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CIPIPIPPGDPRIPSRPDSCIPAFRSAPTCGTGYSAFNFGGESNKREQINSLTAFLDLGQVYGSDEKLALNLRDLTSDAGLLRVNTEFRDNGRELLPFHSLQVQMCATRRRVTNNTNAREVPCFIAGDGRVDENIALTSIHTLFVREHNRLARQLKRLNPQWDSETLYEEARKIMGAYT

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCATCCCTATCCCGGTTGGTGTCAAAGCTCAAACCAAATTGTTTCATTTTGTTTCACCTTTCTGTTGTTTTACTTAAAACTCTTGCTTTTGTAATAATTATCAGATCCCTCCTGGAGAC
CCCCGGATTCCCTCCCGCCCAGATAGCTGCATCCCAGCCTTTAGATCTGCTCCTACCTGTGGAACGGGTTACTCTGCATTTAATTTTGGTGGAGAATCCAACAAGAGAGAGCAGATCAAT
TCACTGACGGCCTTTCTGGATCTGGGGCAAGTGTATGGCTCAGACGAGAAGCTTGCCCTGAACCTTCGTGACCTCACCAGTGATGCCGGCTTGCTGCGCGTCAACACCGAATTCAGGGAC
AACGGACGCGAACTGCTGCCCTTCCACTCCCTGCAGGTGCAAATGTGCGCCACCCGTAGAAGAGTCACCAACAATACCAACGCCAGGGAGGTGCCCTGTTTTATTGCAG
GTTTGTGAGTT
TCTAAGCAGAAATTGAGTTGAATGATTGAATAAAAATGATAATACTTGCTTTGAAAGCAAACCCAGCTACTAGATATTTCAAGATCCAGTTATCGCCAATGTTCAATATTAATAAATGAC
TGATCGACAAAATTGTCATTTTCAGCTCATGTCTTGGGAGTGTGGGAGAGGTAGTAGCACTGTTGCCTTGCAGGAAGAAGGTCCCGGGTTCTATTCCCAGCCCGGGATCTTTCTGCATGT
CCTCACTATGCATGAGTAGGTTCTTTCTGGACACTCTGGCTTCCTCCCACAGTCCAAAAACATGACTATCAGGTTAATTGGTCTCTCTCTAAACTCTCCGTAGGTGTGGATGTATGTGTG
CACATGATTGTTTGTCCTATTTCTTTCTGTGATGCCCTTTGATGGACTGGCAACCTATCCATCAAAGGGTGGACCTGTGTCTCATCCTTGTGGCACTCATCACCACACACGACACCACTA
GGGATAAGTGTGTTGGATAATGGTTGGATGGAGCTCAAGTCATATTCTTAAGGTGGCTCCAAAAGTAAAAATGTCAGCAGGAATTGAGTTGTTGGTGTATTTCTCTGCAGGTGATGGCCG
CGTGGATGAGAACATCGCCCTGACCTCTATCCACACCCTGTTTGTGCGTGAACACAACCGTTTGGCTCGTCAGCTGAAGAGGCTGAATCCACAATGGGACAGTGAGACTCTCTACGAAGA
GGCCCGCAAAATCATGGGTGCTTACACCCAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCATCCCTATCCCGATCCCTCCTGGAGACCCCCGGATTCCCTCCCGCCCAGATAGCTGCATCCCAGCCTTTAGATCTGCTCCTACCTGTGGAACGGGTTACTCTGCATTTAATTTTGGT
GGAGAATCCAACAAGAGAGAGCAGATCAATTCACTGACGGCCTTTCTGGATCTGGGGCAAGTGTATGGCTCAGACGAGAAGCTTGCCCTGAACCTTCGTGACCTCACCAGTGATGCCGGC
TTGCTGCGCGTCAACACCGAATTCAGGGACAACGGACGCGAACTGCTGCCCTTCCACTCCCTGCAGGTGCAAATGTGCGCCACCCGTAGAAGAGTCACCAACAATACCAACGCCAGGGAG
GTGCCCTGTTTTATTGCAG
GTGATGGCCGCGTGGATGAGAACATCGCCCTGACCTCTATCCACACCCTGTTTGTGCGTGAACACAACCGTTTGGCTCGTCAGCTGAAGAGGCTGAATCCA
CAATGGGACAGTGAGACTCTCTACGAAGAGGCCCGCAAAATCATGGGTGCTTACACCCAG

Retrieve as FASTA