Entry information : Pret2CysPrx03
Entry ID 13821
Creation 2016-06-27 (Harold Duruflé)
Last sequence changes 2016-06-27 (Harold Duruflé)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-06-28 (Christophe Dunand)
Peroxidase information: Pret2CysPrx03
Name Pret2CysPrx03
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Metazoa Chordata Actinopterygii Poeciliidae Poecilia
Organism Poecilia reticulata (guppy)    [TaxId: 8081 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Pret2CysPrx03
start..stop
S start..stop
Dr2CysPrx01-1 360 3e-129 1..197 1..197
Cja2CysPrx02 345 2e-123 1..197 1..197
Ptro2CysPrx02-1 345 2e-123 1..197 1..197
Mmul2CysPrx02 345 2e-123 1..197 1..197
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..103 103 N° 2 214..367 154 N° 3 1008..1130 123 N° 4 1240..1370 131
N° 5 2837..2919 83  
join(1..103,214..367,1008..1130,1240..1370,2837..2919)


exon

Literature and cross-references Pret2CysPrx03
Cluster/Prediction ref. Genebank:   103464517
Protein sequence: Pret2CysPrx03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   197
PWM (Da):   %s   21692.13  
PI (pH):   %s   6.51
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSGNAQIGKPAPEFKATAVVDGQFKEIKLSDYKGKYVVVFFYPLDFTFVCPTEIIAFSDRAEDFRRINCEVIGCSIDSHFTHLAWINTPRKEGGLGAMKIPLVADLTKSISRDYGVLKEDEGIAYRGLFVIDGNGTLRQITINDLPVGRSVDETLRLVQAFQHTDKHGVCPAGWKPGSDTIIPDVQKSKAFFSKQ

Retrieve as FASTA  
Remarks
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATCGACTTAT TTTCTAATTT TCTTGCTCTA ATCTGAACTG ATTGCACAAA AACATACGAC GAAGTGAAAA TTTCGTTTGT ATTTTTTAAG TAAAAGCTAA CTTGAGCTAC CTGTCCTGTC  TTTTGTTTAC ATTTGCAATC CTAAGATTAC CCGCATTTTA ATAGCGCAGC CCCTTATAAA AGTGAAGCAC GAATGAACTA CAAATTATAC ACATCTGTAA TTTCAGCCAA TAAATGAATC  CATCAGCAAC AACAAAATTA CCTTGGACAT TCAAGAGACC GCTCTGCACA TCACTCTATG AGCTAACCGG AAGTAGCACG GTACGCCGCT GGAACTGTTC TTTTCAAAAT AAAAGTCGCT  GTTTATCTAT CTATCTATCT ATCTATCTAT CTATCTATCT ATCTATCTAT CTATCTATCT ATCTATCTAT CTATCTATCT ATCTATCTAT CTATCTATnT ATCTATCTAT CTATCTATCT  ATCTATCTAT CTATCTATCT ATCTATCTAT CTATCTATCT ATCTATCTAT CTATCTATCT ATCTATCTAT CTATTTATTT ATCTCTTTGG GGTTTTTTTG GCACATTTAT TTACTTGGTG  TACATTTGAA ATGTTACATT TTTAAATATA CTAACCTAAA AAGTTGAGAA TACTATTAAA TTTTTCCATC CCTAGTGGGT ACCAGACAAA AATCCCATTT ACTTCCCAGC CAGAGCAAAA  TTACCATTAG CCCTTTTGTT TATTATTAAA CATATTGCAT TTATTAGCTG TTAGGCTCAA TTTAGTAGTA TCATTTTTCC CCCTTTTCAT AGACACTTTT GGATTTCAGC TTTCAGCTGG  ATTTCAGATA TTTAACATAA AAAGTATTTT TCTAAACGTG TTACCACAGT TTATTATTTC GAAGTTAAAT TCGATTCGAG GAAACGTCAA AAGTCAAAAA GAAGCGTGAC CTGGGTCGCA  AACCCCATGC TTTTATATTT AAAGCGCCAC ATTTGTACTT CCGGAGGTCA CAGCCGTCCT GGAGTACTTT TTGCGCAGAA TCTCTCTCCT TGGATCCTCT TGCCTTCAGC AAGCCATAGA  CCTCCGTAGC CAAGTTTCCT GCAGCTCTGC GAAACTAAGG TGAGCGCGGA ATATAAAGGT TGCGTCTTTA GTTGAATGTT ATTTTAGGAG TGTCTGCATA GTTTCAGGAA AATGTTTGTC  CACTAAGGAA AGAGGAGCGC AGGAGTATGA GCGCAGCAGA CTGAGCTAAG AATAAGCTAA GCCACAAGCA GCCAGGCAGG CTGTCCGGGT TCACTGCTCC CTCCTCCTCC TTCAAGTGTT  TCTGGCTCTT TCTTTGTTCC TGAAGCGCAG CTAACTGCTC ACGCTGGTCT GTGCTTGTTT ATCGACTTTT TTGTCAAAAC TAGCTGAAAT GCGAGGCTTT CTGCAACTGG TGAAATCCAC  TGCGTTAGTG TTTTTACTAA AACACCAAAG TGACGCAGAA AGGGATTTTT ATTCATTTCT AAATGAAAGC AAAAGCAATG CCTTTGCATT TAGCGTCTGC GTTCTGCAGT GTACCAAATA  AGAAAAAAAT GTTGAAGGGC GCATTTTGCG TCATCACTAT GTTAAATAAT TTGAAACGTG TGACGTTAAC GCTGCAGCCA GATGGCTTAT TGTTTCAGAT TCACATCAAA ATAATTTATC  CTGCATTAGG TATCCCCCTC GTCTTGGTTT GTGCTGATCA TGGTTACATA AGCATAAAAG GCCATTGTTC CCTACTGGCG GACCGTGACT TGCATGTGAC CTCCAGCAGG TGTTTGAAAG  GGGGCTCATG TTAAGACGTT GCTTTTAAAC CAAAAAGGGT TATATTTCAA ATGCCATGTG TTACATGCAC GTTTTCTTTT TTCTTTTTGT TTTGTTGTAA CCATACATTA CCCAAATGTC 
TAGTTTGCTT CTCAGTGTAG ATGTTCATTC TGGTGTTTTT TAATGCTTTT AGTATTTGTC TCCCTTAGTT ATTCACCATC 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATCCCAAGGT CTTCTGTCCA GCAGATTGGT CATGAGTGCA GCACTTGTTT CTGGATTGGA GGTTTCCCTG TGAAGTACTA CAGATCTCGC ACCCATTAGA ACAAACTTAT CAACTTCCTC  TACAAGTATT ATCCTTGTCT GCTCAGGCTA CAGTTGATGG GATAACCTCT TAGTCTCACG CACTGAAACT ATAGTTTAGT TTTGCTCCTT TTTTTTTTTT TTTTTTTTGT TTGTTTTTAA  AAAAGTGATA TTTTTTCCTT GCTGTCATTT GCTACCATCT CTATTAAAAC TGTGGGAGAA CACTGTCTGC TCTGTGCACA TAAATGTCTT TGAATCTCAA TTCATTAATG ACCTCTAGGT  GGCAGCAAAA CTCTAAATCT GACATGAGTC TCTAATCTGT GAGGGGTTTT ATTTTTTTTT CTTCCTTTCT TTTTCTTCTG TTCTTGGACC TGAGGCAGTT GAACAGCTTT GCCTGGCAGA  AGATCACAGT ACGTCACCAA GCTGCCAAGT CTTGGTTAAT ATTGGAGTTA TTGTGGTGGT TGACTCAGCA CAACAATCGG CGATTGCCAA ATGGCTCCAA TCCCTGTTAG GAAAGATTGG  ATAGTTGAAT ATATATGTCT ATATATCCAA TTTAAAATTG AGTGGAAGTG TTGTAATAAA ATGTAATCAT TTTGACTGAA ACCATAATAT TAAAGTATAA AAGTACTCCA AATTAGTAAA  CATCTCCTTG AATAATCACT TCTGTAAATG ACAGAAAATT GGGACATGAA GAAAAAAAAC CTGTGTAAAC ATGCATGTCG GATTTTATTT AAAAGGAAAC CCTGTAAACA TTTAACTATT  TCAGTCATGT ACCACTAGTA CTTTAGGGAT CTTTTTATCT GTTAAATCTA ACCTTTGGAG AAGGTGTGAG GATGTCGTTG CTCTCGTAAA GATTGGTCTC ATTTTATTCA TGTCTTAACT 
AATTACGTTG TAAAAGTTTT AAAATAATTA AGTGAAAATA T 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCTGGAAACGCTCAGATTGGCAAACCTGCGCCAGAGTTCAAGGCCACAGCTGTGGTCGATGGCCAGTTTAAGGAAATCAAGCTGTCTGACTACAAAGGTGTCTTTTTTTTTTAT
TTTTTATCCCTGGTGGGGAAAAAAACATTGTGTGCACTGTATGCTCAGTATCTGATGAGAACCAGAGTTAAAGCATTTTTTTCTGTCCCTCAGGGAAGTATGTGGTCGTCTTCTTCTACC
CCTTGGACTTTACCTTCGTGTGCCCGACTGAGATCATTGCCTTCAGCGACAGAGCAGAGGATTTCCGCCGTATTAACTGTGAAGTCATCGGCTGCTCCATTGACTCTCATTTCACCCACT
TGGCATG
GTAAGAGGTTCTTGGGAGTAAAGTACTTGTACATAGCCATCCCCCCCGCACCCCCCACTCAACAAAAGATGTTTAAAAACTTTTAAAATCAAATTGGAGTGTCAGGGATCCAA
GCTTCTTGCTGTTTAAATTAAAGTAAAAGTTTCATCAGGCTGTCTAGGTATTGATGTTTGTGTAATATCTGCTCCATATGGAGGGACTCTGGACTAACAAGATCCCACCCTAGTCTATCT
GCTGCCCTGCTGCCTTTCTGCAGCTGCTGATAAGCGTCTTAATAACGGCCTTCAATTCGTCTCACTCCTTCTGGAAGAAAAGGAGGTGTTGCACAACTTGCCTGATCTTCTTTTTTTTAT
ATTAGTAACACCTTCCTCCTCCACAAAAATAATTGAAACTATTTCAACTCTTGTGTTGCTTAAGTCAGCTGCTGAGTTGCTTTTTGTTGGATTTCTGCTTTTTCCCTAAAAGTCGACTTA
TAGAAATGTCGCCTCCTGACTTCTTGTTGCTATATCAAACGGCTACTTTGTGCTTTCTGAAACAGAACTTAATGTAGCAGTCATTAAGTGTTGCCAGGGATTATTTTCTTCAGAATATGC
ACATTATATACATGTATAAATATATATATTTTTCTCCACCTCTTCAGGATCAACACACCAAGGAAAGAAGGAGGGCTGGGTGCCATGAAGATCCCTCTTGTTGCAGACCTCACAAAATCC
ATTTCCAGAGACTATGGCGTGTTGAAGGAGGATGAAGGCATTGCGTACAG
GTCAGTTCGACCCCTTAGATTAAAGTTTTTGTTTTTTGGGTGGTTAAAAGGTGGAACATGGCGTTTTAAT
GTATTTTGCTGATCCTGGGGTGTCATTTTGTTCTCTCAGGGGTTTGTTTGTGATTGACGGTAACGGGACCTTGAGGCAGATCACCATCAACGACTTGCCTGTGGGCCGCTCTGTGGATGA
GACCCTGCGTCTGGTGCAAGCCTTCCAGCACACTGACAAACACGGAGAGG
GTAAGTTGATCCAGTTTGCTCATAAAAATTATTATATACTCAAGCTAAATGCTGAACTTTGAAAACCACT
ATTTTAAGGTTTCTAAGTGGAGAGATGCATGAGGATCTCCTATGATAGATTGTCAAATTAACTTTAGATCTGCAAATTCATGCTCTACTCCTGGAATCAGATATTTTGTGCAATAATCTG
GTGCAGTGGCTTCATTTTGCACAGCAACAAAACCACACAGCCCACTAGGCAGAGCAGTAAACCTCAAATTAATTCTGCTCCTGAAACCTGCCTGCTGTATTTGAGTTTAAAACTAACATA
AAATGAATCTTGTTGCCTCGACCATGCCTAGCTTCAAGTTTTTTACCACAATGTGGTTTTAAACACAGGAAACCTGTGGTCAGTCACTGTAGTAAGTCTACTGAATGTGTTCTGAGAAAA
GCCATTGAACTTGGGTAACATAGAAGCAGACGAGGCTATACTTAACCAAAGTCATTAAGTGGGTTAAAGATGAGTTTTTGGTAATCTTAGATTTGAAACTATATCACAACTGTGTTCAGA
TTTTTGCACTATTTTTGCTGTTCTTAAAACGGTAACACTGGTAGCATAGTGTGGCACCGCAATATCAATGTTTGGGATATTGCTCCAACTAATATAATCCACACTATATATAGAGTTCTA
GTTGCTGGTATTTTTAAGATGATGATTGGGGAAACAACCATGACGAGAAATGGTCAGAAAAATTTGGGTTCTAAATATAATCCCAATATTCAACAAAAATATCATAGCTGCATGTTGTCC
TTGTATTGTGCAACAAGCATTGTATTGTAAGGCAATATTTTTATTATTTAAAATAATGCCAGTTATCTTAAAAAATAATAATTAAATGGCTTGGCTTCTTAAGGCTTTTTTTATGTGCAA
CTTAGGGCCATGTGTTTATTTTGGTAATGTACAAAAAAGACAAAATTCAAGAAATGGGAACTAGTTTATTGATGAAGAATTTTTTAAAAAATTACTGATTCTGCCCAGTTTAAATGTAAT
TCATGTTTTTATAATGATGCAAAAGCCGTAACCCACTTTGCGATACACGTGGGGGTTTGTTGGAGTTGCTTTACACAACGGTAAAATACTTGCCACCTAATCATTTTCACAGGCTCCTCT
AAAACTATTTTTGTTTCAGAGGAGCAGCGACCGGAGACGAATAAAGAAACAAAAGGAGCCTATTGCACAAAACCAAATAATACCCTGAAGTTTTACAAACATTTACTGCATCTGAACATG
TACTGCACATATTTGTCAAAAAGAACGTAATGAAACTGAAGTGGCCATCTGCCTTCATAGCTCAGCCTTAACTAGCAGCAATATTGGTTTATCCTCTTGGACATTCACACATGTGTACTT
TGTCCTGTGATAACGTAGTTTATCAACCACATGTGACACTTGAAGTAAACTTTATCCCTCTTCTATCTCTGCACAGTTTGTCCCGCCGGCTGGAAGCCTGGGAGCGACACGATCATCCCC
GACGTGCAGAAGAGCAAAGCCTTCTTCTCCAAGCAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCTGGAAACGCTCAGATTGGCAAACCTGCGCCAGAGTTCAAGGCCACAGCTGTGGTCGATGGCCAGTTTAAGGAAATCAAGCTGTCTGACTACAAAGGGAAGTATGTGGTCGTC
TTCTTCTACCCCTTGGACTTTACCTTCGTGTGCCCGACTGAGATCATTGCCTTCAGCGACAGAGCAGAGGATTTCCGCCGTATTAACTGTGAAGTCATCGGCTGCTCCATTGACTCTCAT
TTCACCCACTTGGCATG
GATCAACACACCAAGGAAAGAAGGAGGGCTGGGTGCCATGAAGATCCCTCTTGTTGCAGACCTCACAAAATCCATTTCCAGAGACTATGGCGTGTTGAAGGAG
GATGAAGGCATTGCGTACAG
GGGTTTGTTTGTGATTGACGGTAACGGGACCTTGAGGCAGATCACCATCAACGACTTGCCTGTGGGCCGCTCTGTGGATGAGACCCTGCGTCTGGTGCAA
GCCTTCCAGCACACTGACAAACACGGAGAGG
TTTGTCCCGCCGGCTGGAAGCCTGGGAGCGACACGATCATCCCCGACGTGCAGAAGAGCAAAGCCTTCTTCTCCAAGCAGTAA

Retrieve as FASTA