Entry information : Pret1CysPrx02
Entry ID 13825
Creation 2016-06-27 (Harold Duruflé)
Last sequence changes 2016-06-27 (Harold Duruflé)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-06-28 (Christophe Dunand)
Peroxidase information: Pret1CysPrx02
Name Pret1CysPrx02
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Metazoa Chordata Actinopterygii Poeciliidae Poecilia
Organism Poecilia reticulata (guppy)    [TaxId: 8081 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Pret1CysPrx02
start..stop
S start..stop
Ipu1CysPrx 376 8e-135 1..219 1..220
Dr1CysPrx 371 1e-132 1..220 1..221
Xl1CysPrx 353 7e-126 1..219 1..220
Gga1CysPrx 349 4e-124 1..219 1..220
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..92 92 N° 2 1293..1449 157 N° 3 3425..3568 144 N° 4 4263..4409 147
N° 5 4568..4693 126  
join(1..92,1293..1449,3425..3568,4263..4409,4568..4693)


exon

Literature and cross-references Pret1CysPrx02
Cluster/Prediction ref. Genebank:   103463762
Protein sequence: Pret1CysPrx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   221
PWM (Da):   %s   24281.6  
PI (pH):   %s   6.79
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPGILLGEAFPNFEADTTSGRIKFHDFLGDSWGILFSHPADYTPVCTTELARAAKLADEFKKRGVKMIALSIDSVEDHKNWSDVMAYANEAGSPLPFPIIADEKRELSVQLGMLDPDERNKAGLPLTARCVFVIGPDKKLKLSILYPATTGRNFDEILRVIDSLQLTAQKKVATPVDWKPGEKVMVVPSLPDSEATALFPNGVTTKEMPSGKKYLRYTQI*

Retrieve as FASTA  
Remarks
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCCGTCCACT CAAGAAAAAA ATGATACGAA AACGATAAAT GAAAAATGTC AGCCGCTTTG CGAAGGTGTT CGCTCCTTTA GCTCATCTGT TGATAATTCC TGTCACGTCC GGGTACCTTG  AAGCGAACCG CCATATTTGT TGCTCTTTAC GCAGAGCACC CTGGGAAATT GAGTCTTTCT TCTGTGTTTG TCGCATTGTT CTGGTTGTTC TCACTTTCCT AATACCCATT TGTGACAGGT  TTATTCCATC AAACCAAATA AGTTACAAAC AAGAAACAAT TCATACAGTC TGAGCACAGG CTGAGCAGAG TATGTGCAGT CTGATAGGTT TTGTTGCATG TTTTCCTGCT ATCTTCAAAT  AATGCTTCAC CCACCAACCA AACAGATGAA ACAGAACAAA TGAGTGTTTT AACTGGCTAA ATGGATTATG TGTTCCTAGA AAACAGCTCA GCAGTAAACA CAAAAAACAC TTCATCACGC  GGTCTGCAGT AATAAAAATA CAAAGTGTTG CTTTGTTGCA CTCCAGAGTG TAACAAAGCA ACACTTTGTT AAAGCAGGGT TATATATTAT ATAATATATA TATTATTTAT AATATATATA  ATTATATATA TATATATTTT ATATATAATT ATATATCTGT AAATCCCAGT GAGCCCCATG TTTTAATTCT TAAGTCATAG TACATCTGTA TTCTTTTTGA AACAGGGACA TCTTTCGGTG  TTTTCTATGT TGCAAAGTAA TTGATATAGA ACGGAACAAA GCATTGAAAC CACAGTGAAC ATCCAAACCA TCAACAATGA CCAACTTCCT CTGTCCCTCA CAGCTTGATA TTGTGGTATT  TGGGATGATT TGCTGTGTTT ATTTTCCGTC AGGAGTTTTT GATTTTGGCC AAAAAATTAA GTTTTGCTCT CGTCTGGCCA GAACACCTTC TTTTACAAGT TTACTGCACA TACATTTTTG  TGGTTTGTGG CAAACTGTAA ATAGGACTTG CGATTTTTTT TTAACAATGG TTTTTTTTTT CATTTCCTCA AAGTCAGCAT TTGTGCAGTG CAAAAATAAG TAGTCTGATT AATGATCTCC  TTGCCCACAC TGTGAGATTA TATAACACAC AGGTGGCTTC TGAAAGCAAT TTTGTGTACT AGACTTTACT TACAGGGAAA TTCAATAGAG AGGGCTGTAT ACAATGCATG CCACACTTTT  CAGTTTTTGA TTTGAAAATA TTTTTCAAAA CCCTGTTGCA TTTCACTCCA CTGTTAGTCA CTACTTTGCT TTGGTCTGTC ACAAAAAAAA ACACACACAC ACACACACAA AAACAAAACA  CACTACTACG CACAAATTTT GTCGTTATAG AAAATGTGTA AAAGTTGACG ATGTTTGATT AAAGGCACTC CATTACTCAG TACTTGTTAA TATCCCAAAA TAACTGCACT GGTTGTAGTT  ACGTTATGTA TGTTACATTA ATCTCTAAGG CAATAAAACT TCATGATAAC AGTGTATCCT GTGGATATAA ACATTTTAAG TTTGAGATTT ATGTAGTTCA AATCAGCTAA AACAAGGGCT  CTGCCAACTT ACTGGAAAAT TACAGCGTTT TTCTTTGCTA TCACTAAAAC TATCACTAAA AATGCCTTCA CATAAAACTC ACTTTGAACT AATTTGAAAT ATTTCTTCAC CATTGTGAGT  GTCAATGTCT TTTTCTCTGC ACATTTATAA CTAAATAAAA TTCTGAAATT TTATACATAA ACTGCTTCTT TCTCTTACTT TTTGTATTTA TATAGTTTAT ATTATCCATT CAGGTACTGG  TTAAGGATGA AAAGAAGAAA AATAATGACG AATTTAACGC CTCTTTTCTA ATTGGTCAGC GGTCTACAGC GCGTTATTTT AACCACGCCC CCTTTGCCGG GTACATTCAC GCTCCCCATC 
CGCTATCGCA GTGCCTGCTG CTCCCTTCCA GGTCTGTCAG CCTTTTACTT AAGCGTGTGA GCTTCAGCTT AGAGCCAACC 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGACAAAGAA ATACAAACCA AATAAAGAAA TATACATCGC TGTTTTACGC TTTCTGCATG TAGACACGTA GAGGTTCTAT GACCGACCAC TAGATGTCCT CCTCCAACCT TCAAACATAA  AGCTTTTATT CTGTCGCTGC AGAGCTGTAC TCTGCCAGTA GATGGCACTA AGCGCACACA TTGCCTCCAA CATGGAATAG AAACATCCTA TTGTTGGAGT GAAAGAAGCG ACCTGTTATA  AACGACTAAG AACAAGATGT ATCATGGACT GAGATTACTA TTTACACTCG AAGCCACATC TAAGAATGAC AAAAACAGGT TAATTTCAGA GCTGATATCT ACTTTCATTC ATTGCACATA  TAGGATGCAA TCAACTTTCT CTCATCATGT TCTGTTTTTG TCAAATAAAC CAAATAAACA CTCTTTGGAA CAAATGCCTC TGTATGCGTT ATCGTCCCTG AGTTTTGCTT GGCAACTACG  AGAATGAAGA ACTCTCAAAT GCTGACATAA GGATGAAACT TCAAACCGCC CCTTGACTTT TCAGTTAAAA GTAGATTTTT TTTTTATAAA GCGCCACAAT AAATACACTA ATATAGTTGC  ATTTTAAATG CTCATTTCTC ACATACCCTC TCTAAACTCT GCATTCACAC TGAAAGAATA ACTTAAGTTT GGTGAAAGTA GGGGGGGAAA TACCGCCATC TTGAATTGTG ATATTTTTTT  AGTTTCTCCC TTCCTTCCAT TAATCATCCC CTGACCTCTC AGGTTTATCT TGTGAACCCT TAGAGGAGTC TGACCTCCGG GGCTAAGAAG AAGCATACTC CGGACATTAT CACTTAGACA  TTATTCTCTA GAAGAAAATT TGGTTTTAAG GCTTTCACAC ATTTTTTTTT CTTATGGAGA ATGCTGTAAA ATGTTTACAT GAAGGCCTAA AATTTTTTGT CATCTACTAA ACAACTTCGG 
CATGATTAGC TGACGCATAT GAACTCTGTT AAATGACTTT T 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTGGGATTCTGCTGGGAGAAGCGTTTCCAAACTTTGAGGCGGACACGACCTCCGGAAGGATCAAATTTCACGATTTTCTGGGCGACTCGTAAGTGCGCACGCTCGGAAGAGCTCTA
CCTCTAACCATAACTTCTCAATTTTTTGCATCTTTGAGTAACAGTGTAACATGTTGTGAAAGCCTGCTCTCTGGAGTGTGGAGTAGAAAGTTATGACATTGCAGTAGATCCATTCTGACT
GTAGTTTTATTGTGTTTATCTGATTCCGTAAGACTTTAACAGTTAAGTGATGCCAGCTGGCTGCAACAGATAGGCTTGTATAAGGATGCAAGGCTTGTATAAGGATGCATACCGTGAATA
ATTTACCTGTAATCTTTATTTTACATGTTTCACTGACCACAGAACTAATACAAAGCCTCGAAAACAGACAAATTTATAAAATTCATATAAAAAACATACTTTGAGGCTTGATTGTTCAAA
GATGGTGTTAATTTGGTGGGACTGTATGTTTTTACTCATGCGTAAAGGTGCATGATCTTATTACATGTTTTCTTTCTAATAAAACTGGTAAATCTTGCCCAAACAGGAAAAACTTGTTGT
CACCAACCTTTAAATTCAAATTTTGTGGATTTCTTTTCCTCCTGCTGACGCCACGCAGATGAACACGTGCTGGACACTAACTCATTTCTTTCTCACTGTGGGAATAGTTGTTGGACTGGG
AGAGGCAGTCATCTGTTAAAGCTGCGTTCTGGATTTTTTTGCCTCCTGTTATGCTTCTCATCGATTAAGATTGTTCCTGCTCAGTGCACGTGGGAGCTCGAATCCCTGGAAAGCGCAGGA
CAAAGCCCATTTTGAATAATTTGTTGTTGGAACTTGCTCCAGAGGGCATGGGGGGAGGTTGTGTGATTCTTGTCAGCTAGACATCAGGTGATCCTCATACCGCCTGGGGCGAGGGGTTTT
TCTGTTCCCCTTTTACTGCATGGGATTCCAAATCAAAAGAAACAATGTGATGTTTTGCTTTTGATGTCTGCCATAGCTTTCTAATTTTCTTAACTTAAGTTGCTCTTATCAACCCTTCAG
GGGATTTGTGAATAATAAATCCAGAAAGCATGTGCCCCTCAGCCTGAGGTTCCCAAACATGTGACTAGAATGAGGTGCACTGACCTTTCAGGCTTTACTGAGGTCCAATTGTTAATGGCA
TGTGTTCTTAAAATCATATGTGTGAATTAAGCTTGACGTCGATCTGTCCGGTAGAAACGATGGATTTTATTTGTTTGTTTTTTTTCCTGCAGGTGGGGTATCTTGTTTTCCCATCCGGCG
GATTACACTCCCGTCTGCACCACCGAACTCGCACGCGCCGCCAAGCTTGCCGATGAGTTCAAGAAGCGCGGCGTGAAGATGATCGCCCTGTCCATCGACAGCGTTGAGGATCACAAAAAC
TGGAGCAAG
GTGAAGCGCACTAACTCGGAGTGGACCCAGAGTGCTTGTGGATCGACCGATGACGATCGGTAGTCGTTTGCACTCTAATGGCGTTGTTGCTTGAAATCCTCATGACTAGGG
GAAGCAGGATAATTGTAATAAGCCTCAAACTGAATCAGGGATTTGAGCATTTTATTGACGTTTTGTTCTCATTGACTTTTATTGATGGGTCAAAGTCCAATCATTTCACCCGTAGAGACA
CTCCTCTAGTTCATGAATGTTTACTAGTCAATAAAACATGTTTTACTATTTCTGGTGGGTAAATCAATTTTCTTATTTTGGAAGAAGCTAAGGAATGTTTAGTTTAATCCATGTGAAGGC
TCACAGTCAGTAAAGTTAAACATTAGCGCTTAAGCACATCCCAACTACAAGCGCAGCAAGCAAAGGTTGGAATCATCCAGTTTTTTTCTTGTTTGCTAATCTGCACCCAAAGTACATTTT
TGTTCTCCTCACTCCCCCGTCTATTCAGTTTATTTATATGGACCTAATCACAACATGTCATCACAAGCCACTTTACAAAGAGGGGAAGAAAAGTTATGCAATCCAAACATGCATGCATTT
CAAAAGATTCCAATTGTCAATGTTTCAAGTTTATTTCTCTAATCAGTTAAAATGTTTTCTGAGATTGCTGAGTCATTGACTTGCAGCATTCACTCCTCTGGGATGAGCATGTCGCGGCAG
CAGAAAATCACGTATGTTTGAGAAGACGGAGCGTACTCGTTTAAAAAAAGAAATGGAAACACTGATTGTAGAGCACTTTCTATGTCGCAGAAGAGTAAGAAATTAATAGCTGCAGTAACT
CCTTTAGTGGCTTCATGTAGGAGAGAAACGCATCTTTAACAGATAAAGTGTTGTGCCAATTTTCAAACTTATAGGGTGAGAGAGAGCACATCAGTCACAGCAAAAGTTCAGCAAATAGCT
TTATTTAGAAGAGATGCATGGTTAAACACCGACAGTCATGGCCAAGTGTATCGTCAATTAAAGGATAATCTTCAGTTGTTGGCAGCGGTAGCACTTGAACCTGGTTTTGGCTTTGTAATT
GTAAAAGTAACCATCTGCCTCATGGAGCTGGTTCCTGCCTCCCATTCTACTTTTTGAGATTCTCTGAACCAGCAGAAAAGCTGCAGACTGAGAGCAAAATGCTCTGTTGGGAACATATGG
ACCAATCGGATCTTTGACGTTTGATGGAGCCTGATTATTAAGGGCTATTTTCTTTTTCAAAAGATTATGTCTTGTCAGAATTTAAAAGCAGAAAAATTTGTCATCCGGGTTTTTATGTCT
TCATGCCTGTAGTCTACCTAACTGATCGGATTTATGGATGAATTTAGCTGAGTGTCATCAGCATAGGTGGAGATAAGCATAGGTGGAGATAAGGGTAAAGAGAATTGCTCCAAACACTGA
ACCCTGTAGGACTCCACAAATGGACTGTGAAAAAGACTTGATTTGTATCAACAAACTGGAATCTGTCAGACAAATAAACCTGCTTAGTGGTTGTTCCCTGAATCCCTATAGCACGTTCAA
GTCTTTCTAAAACAATATTGTGTTTGGCTGTTTTGAAAGCAGCACTGGGCTCTAAAAAGACCAGAACAGATACAAGTCCGTTATCTGAACCCATTGGAATGTCATTAGCGACTTTCACCT
GTGCCATTGTTTAAAAAAATTAAAAAAAAAAATCAAAATTAACCACTCCCACTATTTTAAGTCTCTGAATGGGTTAATAACCAGCATCCTTTTTTATGGTGTTTTTGGAGTTGATTGAAA
ACTGTTACTTCTGTCAAAGAACTGCTGCACTTTTTAGTTTCTCTTTAATGTGTTTTCATCTTAAAACTAGAACCAATATCAGCCTGACCAGCGCACCTCTAGCTACAGTGACACTGTAGA
AAACTCTTCCAGCTGTAGCTATAAGTAATGTGTAAAGCGTAATGTGTCTGACGCCCCGTTACAGGATGTGATGGCGTATGCCAACGAGGCCGGCAGCCCTCTGCCTTTCCCCATCATCGC
CGATGAAAAGCGAGAACTGTCGGTCCAGCTGGGCATGCTGGACCCCGACGAGAGGAACAAGGCTGGACTACCCCTGACTGCTCGCTGT
GTAAGAATCCCGCTTTCTGCCTGGTATCGATA
ACAAATCAAAACTTAAATTGAAGTTTGACCATTTTCTCTGGATCTAGTTGGTCTTAAAATTGATATCAGATTCTTTTTTTAAAATGGTAATTCAGTGCATCAAATCTGAAAACATCCACT
TGTTCAGACCACAAGCAACGACCCAGCATGTTCTCTGATGCACGTTTTGTTTTCGGAGGTAATGTTGTAATTCCTTCTGTTTGATTCAAGACTCCAACCTCTGCAGGTCCAAAGAGAACA
TGATTCAGTTTTTGAACAGAACATTTTACAGAAATGAAGCTGTGCATGTTATACTCCTGCACAGATGGAGAAATCATGGAATGGGATTTCAGTGTTTTGTGAGGCTCTGTTAAGTTTTTA
AAATGGCATTGGGGAAAGGCAAATCCAGATTCTCCTCCGCCCCCTTTTCCTTCCTTGAGTACTCCTCTCCTTGCTTCCTTTCTTGTGTCCTTCCTTCCTATTCTTTCCTCATTTATCCTA
CCTAGCTCCTCTTTTCCTTATTTACCTCCCTCATTTCTTTCCTAGTGTTCTACATCTCTACGTTTAAACACTCTGTTATCCATTAGCGTTTATATTCTCAGGGCATTGATTGGTTTAGAG
GCAATAATTTCTTGGTCTTGCTCTTCGAGACAAAATTCAGATATGATCTGGATTCCTTTAAGGTGTTTGTGATCGGCCCGGACAAGAAGCTGAAGCTGTCCATCCTCTACCCTGCCACCA
CCGGGAGGAACTTTGACGAGATCCTCAGAGTCATCGACTCTCTGCAGCTGACGGCGCAGAAGAAGGTGGCCACACCCGTCGACTGGAAG
GTACGAAGTTCAAATAACGCACACAGCCTCA
GCACTGTCCCAGTCATGACGCACTACTTATTTTTTAATCATGTGATGTGACAAACCATTGCCTTCTTTTTAATTTATGTATTTACTTCTTAACAATTAATTTTTTGCTTTGTTTTATTTC
TTATTAGCCTGGTGAGAAGGTCATGGTCGTTCCTTCACTTCCCGATTCTGAAGCCACTGCTCTCTTCCCCAACGGAGTAACAACCAAAGAGATGCCTTCTGGGAAAAAGTACCTGCGCTA
CACTCAGATCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTGGGATTCTGCTGGGAGAAGCGTTTCCAAACTTTGAGGCGGACACGACCTCCGGAAGGATCAAATTTCACGATTTTCTGGGCGACTCGTGGGGTATCTTGTTTTCCCATCCGGCG
GATTACACTCCCGTCTGCACCACCGAACTCGCACGCGCCGCCAAGCTTGCCGATGAGTTCAAGAAGCGCGGCGTGAAGATGATCGCCCTGTCCATCGACAGCGTTGAGGATCACAAAAAC
TGGAGCAAG
GATGTGATGGCGTATGCCAACGAGGCCGGCAGCCCTCTGCCTTTCCCCATCATCGCCGATGAAAAGCGAGAACTGTCGGTCCAGCTGGGCATGCTGGACCCCGACGAGAGG
AACAAGGCTGGACTACCCCTGACTGCTCGCTGT
GTGTTTGTGATCGGCCCGGACAAGAAGCTGAAGCTGTCCATCCTCTACCCTGCCACCACCGGGAGGAACTTTGACGAGATCCTCAGA
GTCATCGACTCTCTGCAGCTGACGGCGCAGAAGAAGGTGGCCACACCCGTCGACTGGAAG
CCTGGTGAGAAGGTCATGGTCGTTCCTTCACTTCCCGATTCTGAAGCCACTGCTCTCTTC
CCCAACGGAGTAACAACCAAAGAGATGCCTTCTGGGAAAAAGTACCTGCGCTACACTCAGATCTGA

Retrieve as FASTA