Entry information : KflKat04 (kfl00027_0240)
Entry ID 13848
Creation 2016-08-22 (Christophe Dunand)
Last sequence changes 2016-08-22 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-08-22 (Christophe Dunand)
Peroxidase information: KflKat04 (kfl00027_0240)
Name (synonym) KflKat04 (kfl00027_0240)
Class Catalase    [Orthogroup: Kat001]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflKat04
start..stop
S start..stop
KflKat05 660 0 77..573 113..611
NOpuKat01 558 0 77..566 5..486
PfKat01_Pf5 555 0 77..563 5..482
PpuKat02 548 0 77..562 3..478
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 143759..143879 121 N° 2 142963..143183 221 N° 3 142583..142693 111 N° 4 142143..142315 173
N° 5 141655..141769 115 N° 6 140785..141000 216 N° 7 140186..140320 135 N° 8 139626..139745 120
N° 9 139100..139162 63 N° 10 138686..138754 69 N° 11 137979..138116 138 N° 12 137333..137602 270
complement(join(137333..137602,137979..138116,138686..138754,139100..139162,1396 26..139745,140186..140320,140785..141000,141655..141769,142143..142315,142583..1 42693,142963..143183,143759..143879))


exon

Literature and cross-references KflKat04 (kfl00027_0240)
Protein sequence: KflKat04 (kfl00027_0240)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   584
PWM (Da):   %s   65659.69  
PI (pH):   %s   7.99
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSAMASRVAEKGLQGQSIFQRVQDNKQFLTGTAFAAPPACQGCAQLRREARQQAPRAGLFNGNGKPGEHYIKPKETLTTASGKPVGDNTNSITAGRRGPLLLAEDFHLYEKVHFNRERIPPRSVHEKGAGAFGTFTVTKDISKYTKAKLFDRIGKKTEIFARWSVVAGEHGSADSVRDPRGFAVKFYTDEGNWDLVGNNTPIFFIRDPLKFPDLIHSQKRDVRGLRSWTMRWDFWGHSPEATHVLWLMGDRGLPKSYRHMNGYGSHTFSLVNDNNERVWCKFHMKSEQGNESYTDEEGIALSGENPDLFNEDLFTNIQNGNGPKWKMFIQVMTDKQADEVPYDPFDLTKIWPHKEFPLHEVGELHFDRNPVNYFQDVEQASFAPANVVPGIGYSPDRMLQARLFSYKDAAVYRLGINHEQLPVNKPRCPVFNYHSDGFMQTQNGAGPPYEPNSFGGPAEDARYVDPAVPLQMSGEGKRYNHRADSDDYSQATALWHIMKPDEQERVITGITNTMTKGKGAGCKSDPVPKKIQQLNLYHYYRVDKSLGERLAESLGLDLKETIARAEKDLPKEVPALVSL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (11 introns). Similarity with bacteria and Cyanobacteria Kat. (recent LGT?)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCCTCAGCAATGGCGTCTCGCGTGGCAGAAAAGGGGCTTCAAGGACAATCAATATTCCAAAGGGTGCAGGATAACAAGCAGTTTCTGACCGGCACCGCTTTTGCAGCCCCGCCA
G
GTGGGTCTCTTTCTCCCATTGGTTCTGTCTTGCACAGAGCGGCCATGAGTACTGCGTGGAACGATGGCTGCATCTTGATTAGAGAGCTTAAGCAACTTGCTACCCTGTTCTACCAGCCA
CTTTTCTTGGGGGGTCCGGGGCACCATCCAAAGGATCCTGGCAAAGAGCTCCCATCTCCTGTGAATTGAAGCCAATGTATGCATGCAGCTCCCCAGCAATCTGCTTTGATTGTAATGCAT
GTAAGGGGCCTCTGGTCCTTTGCGTCAAAGGATACTTTCTGCTAGACAGTATGCTTAATCTTTGAACAATGAAATATGGGCACCCCCTTACTGATGGGAGAAACCGCCGTTCAATGCCAA
AGTGTCAGAGTGATTATGTCACCAGGCATCTGCTCTGACGTGAAAGTGGATCGTTCGAGATAACCTCTTAAAGGCCCTTGTTCATCTGCTGGCTGAGCTTTGGCATCCTATCCTGACACT
TTGAAGACCAAATCACGTCCTCCTGGAATTCCCTTCCTTGTAAGTGGTGCCCTGATCCTCAGGAGTTCTATGCTGACATCATCCTCTTGTCAGCAGCGTGTCAAGGCTGCGCACAGCTCA
GGCGGGAGGCTCGCCAGCAGGCCCCGAGGGCAGGGCTCTTCAATGGGAATGGAAAGCCGGGAGAGCACTATATCAAGCCAAAGGAGACGCTCACAACTGCGTCTGGCAAGCCTGTTGGGG
ACAACACAAACAGCATCACTGCGGGCAGGAGGGGACCCCTGCTCTTGGCCGAGGACTTCCATCTGTATGAGAAGAAT
GTGAGGGGCCTTACATATGGAGGTTGATCGATGCAGCTCTTCA
AATTTGTCTCATATGGGTTCTTTTAGAGGGACTGTTTTTGCTTGGGTCGGTTTCTAGTCCAGAAAGGCCTGAAATGACAAGTACGATCAGACTCTTTAGGGACTCCCTTGTTTCCTATAC
TGGTTATGCATGTCTAGCTGTGTCCTCTGTTGGATGCTTTCAGCCAATTCCTCTTTGTTATTACTGTGAAGGCATCTGGTCAAAACGGCTGATTTGCAACCAACAGGTCCATTTCAACCG
GGAGCGCATCCCGCCCCGGTCAGTGCACGAGAAGGGTGCCGGTGCTTTCGGCACCTTCACCGTCACAAAGGACATCTCGAAGTACACAAAGGCAAAG
GTGAGGGAAGCTTGAAGTCGAAG
CAGTTTATTTCATTGCAAGTATATCTCTGAATTGATATTGCATCGTCTGTGTTGATTGGCTTGATGATTGGAAGATTTGAAAGCACTGCTCCACGTCCTATAGTTCGCTCTTATACTATC
CCCTGCACCTCGAGAAGCTGGAAACGATAACTGTGGAATGCGGCCCGTTTGCCTGTCTTGGTATCTGCTGCGAAAAGTTGCGCCCATTCATTCGATTTCTAAACCGGATCCTGTTTCTAT
ACAGCTGTTCGACAGGATTGGCAAGAAGACCGAGATCTTTGCGCGGTGGAGCGTTGTTGCGGGCGAGCATGGGTCAGCAGACTCGGTGCGCGATCCTCGCGGGTTTGCGGTCAAGTTCTA
CACGGACGAGGGTAACTGGGATCTTGTTGGCAACAACACGCCCATCTTCTTCATCAG
GTGAGCTTGCTCATGATCTCCAAGCCTTACAATGGTCTGAGAACAAACTTTCGTAGAATGCTT
CTTGACGTCTTTCAACGCATTGAATCTGTGCTTTTCTTTACGGCTATGGTAACTCGACCCTTTTTGTTTAGCCGCTTGTTGGGACATGGACCAAAACCACATGTGCGGAGATAACCAATG
AGACAATTCGGTCTTTTCTATCGAACCCACGTGCCTTTTCTGTGCAAGATCTCAAGGACGGAACGCTGTAATGCGAGTAAAGTCTGTAAACGGCTGTTCCGGTAAGCCCCAGCTGCTTGA
AATTCTGAGGTGAGCAATCATTGGTGCCATGTCTGCCTAGCAGCACTTAACAGTCTCACGACTTCTACAGGGACCCCCTGAAGTTCCCCGACCTGATCCACTCTCAGAAGCGTGATGTGC
GCGGCCTGCGCTCCTGGACCATGCGCTGGGATTTTTGGGGCCACTCGCCCGAAGCCACCCACCAG
GTACTGGTCGAGCTTCTTTTTCCGGCTCCTCAGTTTTCTCCATCGTTGATTATCT
CCTCACTTCTGTCTTCATAGCCGTTGGAATACTGTCGGATCCCTAGTGCTCTGGTTTGTCTACCTTTCTGAAGTTTGGCGGCCTCTACTAGTAAAATCGTGTGACTAGACGAGGGGAAGT
AGGACGGCTCTCAGCCATTCGATTAGGAAAGGAGTTGCCAAAGAGCTGATTACGGAAGGACTGACGCTTGCTCACTTCCTGCCAATGCTGGTCGGAGCCCGAAGTTGCCCGTCTCGGGGT
TGTTGGCTTGCGTAGATAGAGGCAGACTGCTCAAAATGGTCGGGTGGTCGACCAGTAGTCTTCCGCGGATCCGTACACGGCTGATATCAAGCATCGTGTGGGACATTGTAGCTTTCTCGA
CCGTGATCAGAATGTGGATCGGGAGGCTAATTTACAGATCGAAAAGCAGCGTAGACGCTAGGACTGGACAAACGGTCTCCATTTTGAAAATATTTCTCTGATTCGGCGTCTGTCAGCGTC
CACGAGCCTGGAAAGCGCTGGACACGCATCAGTATCGAACGAGGGCCCTGACGGGTAGCGTGACATTCAGGGTCAACGCTAAATCCGAAGGTTAAGCATTTAACCGCGCTCGTTTGCAGG
TGCTATGGCTGATGGGCGATCGGGGTCTGCCCAAGTCGTACCGGCACATGAACGGCTACGGCAGCCACACGTTTTCACTGGTTAACGATAACAACGAGCGGGTTTGGTGCAAGTTCCATA
TGAAGTCGGAGCAGGGCAACGAGTCGTATACTGACGAGGAAGGGATTGCGCTGTCCGGAGAGAACCCGGACCTGTTCAACGAGGACTTGTTCACG
GTGAGGACGTCCGAAAATTGTGAGG
TAGTCCACGCAAGTGCTAGCCAGTAACACCATGGGGACGTCCGGAACATCTGAGGTAGCCCTCGGGAGTGCTAGCGATTGATACGATATAGTCGAGGTGGCGGCCAAGTAGTGCTATCCC
GTAAGGGTCCAGCTGTGGGATACTGGAAAATGCATCGAAAAGATAGTCGTGCAAGCGGTACAGGGCACATGGGCGCAGGGCTTTTATCAATTTACAGATCAGTAGCGCGGCACAACGAGG
AGCTCTGTTACATGTATGCAAGTTAGAAACGCCAAGCCATCCAGGCGTGAAAGCGCGGCAGAGACGCGCTTTAGGGGACGGTACGAGAAAGACGCACGATCAGGGTCGATGCTGAGCGAG
ATTGGAAAGCGCAAGTAAAGTACCCACGCAATCATTGGTCGCAGACGTGTTGACGGACTTTGTCTTCTTTGCGCTGCAGAACATCCAGAACGGCAACGGGCCCAAGTGGAAGATGTTCAT
CCAGGTGATGACGGACAAGCAGGCCGACGAGGTGCCCTACGATCCGTTTGACCTTACCAAGATTTGGCCACACAAGGAGTTCCCGCTGCACGAG
GTACGCTCGAAAGAGGCCCATTACTT
CGAGAGACGTGTTTGAGCTTTGTGACGGAAGCTGAGCAGGAGGTCAGGAACCTGCGTTGGCAATTGCACTATCATCGACAGAAGATTAACCTCGCAGGAAAGAGTCCGCCGCCAGCAAGA
TTTCATATGACGTATAGCTGGACGTTGCGGGATGTGCCCAAAAGTGTGCACTTTGGCATGGTGGGAAACCTGTCGAACAGCGTCAAACTTCAAACAGCGTCTTCGTGGCCTTCATCAGCC
TCCTTGCAGCGATTGAAAGCGCTCCTTTAGCGCCTTTCCCTGCTCATCCGCGCGCGCTGTGTCCGTCGGCCCGGAGTGGTAACGCAAGGAGCCCGTCAGTTCGAGTTACCAGGCACACGA
AAGGCTTGATGCGCAGCCAAGACAATACATCAGACTCACATATTTCTACTGCAGGTGGGCGAGCTGCACTTCGACCGCAACCCGGTGAACTACTTCCAGGACGTGGAGCAGGCCTCGTTC
GCCCCCGCCAACGTCGTGCCCGGCATCGGCTACTCCCCCGACCGCATGCTGCAG
GTGAAGAAACGGCTTTGTTTCCTTCTTTATCTGTTTCGTCCTTTCTCGGTTTCCTTCATCGTTGTC
TGCCTCGTTATCTGAAGCTCGCCAAAATCGAGCCGTCCTTCTTTATGCGATTTCTGTGAAATGAGCCGTGGTCAGCAGCAGGCTTCCAGGACCGGGTTAGCGGTTGAAATTGAGGTTTCG
ATATGTTTTGAAGGGGCCAATGGTATATCATCTGATTGGAAGGCTACAAACAGGCGTCGGGCAGACGCTCCCGCAAGCTAGTTTCGCACCTTGGCTTCGTCGTTTACAAGAAGTCCAGCT
AGCATCAAGAAAAATTTCACCAGGATGCTGTCTCGCGTTTCAGAATTCTTCCAAGACTTCTATAGCAAGTTGCGTGGGAGATACCGCCACAACTTTACCGCGTCTAAGAGAAGAAAAAGC
TAGCCTACTCAACTCTTTTCCACCGCGCTTTGTGCAGGCGCGTCTTTTCTCGTACAAGGACGCGGCAGTCTACAGGCTGGGCATCAACCACGAGCAACTGGTGCGCACGTTCCGCCTTTC
AGTCTCTGTTTAAGTGTTTGTTCGACCTTTTTGGGACCTCGTTTTGGAGAAAAGCTGCGTCTCCTCGCATTGAAGGCATACTTCGGAGCAGCGTTCCATGATCTTTCTGCGGGCGCTTTC
TCGGCTTTTACAACGGTCGTTCGTGTGATGTACACAAGCCCAACTTCTTCGTATCCCACGTGAGTCTGCGCTCACTTACCTACTTCAAAATGCTCCGTTTGGTATCCTGACCGGTTCTTA
AACTTGTAGAAGGACAAAGTGTCCCAAGATTATTTTCCCCAGCTACGACTTCACAGTTCCTGAGTATTTAGGGTTTTCCTTGCAGCCGGTGAACAAGCCCCGGTGCCCGGTGTTCAACTA
CCACTCAGACGGCTTCATGCAGACGCAAAACGGG
GTAAGAATTCATACATGTTCTGTTCCTGGTCCGAGTTGATCAAAGCAACAAAACCGGGCCTGTAGTAGCAGGCTTCAGCACTTGGC
AGTTTGCAGTCGGGTTTTCTGCAACTGGAGAAAGACTCCGCTGTCTCTAATCGTATCAGTAACGGACATGCTTGGATCTACCACGTGGCTCTGCGCCGTCGGTTTCTGCTTGCCGCTATT
CACTAAGGGAATGCGTAAGGAGGAAAACTGTTCGTGTGCGGTTACCTCGCACTCACAACCGGCCATGCGGGACTTATGCAAGGCAGGAAAGCAATTCGAGTCACCCATTGCACGCCTACT
TTTCTCAACAAATGAAGATCCTCCGAGCTGGGTTCTCGGTCGACAGGTTCGTTCGTTAGTCACACGATCGCTAGCTCCATTGGTTTTGCAGGCGAAGCGGCGACTTCCTAAAATATTTCT
CGAAATATCTCATACCATGATGGAGCACCAATCTATCACTAGATATTGGCCTTCGAAAAACCAGAGTTGACAGCGTATCTTGTCCTGGATCTGGCATTGATTTTCCCCGTTTTTGTTTTG
CAGGCCGGCCCCCCGTACGAGCCCAACAGCTTCGGCGGCCCCGCCGAGGACGCCCGGTACGTGGACCCGGCCGTGCCCCTGCAGATGAGCGGCGAGGGCAAGCGGTACAACCACCGGGCG
GATTCGGACGACTACTCGCAG
GTACGGACGTCCGCTTTTGTTGCAGGAACCTTGGTTGCGATGCTGGAGTCTGTCCGGATCCTTCGCTCGGTCGCCACGCGGACTGGTCCCTCTCGAGTC
ATCCGACTGAAGCGCTCCAATCCAACACAGCACTCCCAATGTGACGACGTAGTTCCTACTTCCTTTCCGTCATTCAGCGTGCCGAGTGAAGGCCGGGATTGTCGTTGATTTTTTGCTGCG
TCCCCTGGATTCTGCTTTTCAAAAACTTCGCCGCTCACTACAAGAGCGCCCTCCGCTGCTTATCATGTGTGTTTAGCTTTATATGAAATCTCCAAAGAGACGCAGGTCTTTGTGAAATTG
CTCACTTCAAGGTTGACCATTTACTCGCTTCCCGCAGGCGACCGCTCTTTGGCACATAATGAAGCCGGACGAGCAGGAGCGCGTTATCACCGGCATCACTAACACCATGACCAAGGGCAA
GGGCGCCGGGTGTAAATCCGACCCGGTCCCCAAGAAGATCCAGCAGCTGAACCTGTACCACTACTACCGGGTGGATAAGAGCCTAGGGGAGAGGCTGGCCGAGTCTCTCGGGTTGGATCT
GAAGGAGACCATCGCGCGCGCGGAGAAGGACCTTCCCAAGGAGGTGCCCGCGCTTGTGAGCTTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCCTCAGCAATGGCGTCTCGCGTGGCAGAAAAGGGGCTTCAAGGACAATCAATATTCCAAAGGGTGCAGGATAACAAGCAGTTTCTGACCGGCACCGCTTTTGCAGCCCCGCCA
G
CGTGTCAAGGCTGCGCACAGCTCAGGCGGGAGGCTCGCCAGCAGGCCCCGAGGGCAGGGCTCTTCAATGGGAATGGAAAGCCGGGAGAGCACTATATCAAGCCAAAGGAGACGCTCACA
ACTGCGTCTGGCAAGCCTGTTGGGGACAACACAAACAGCATCACTGCGGGCAGGAGGGGACCCCTGCTCTTGGCCGAGGACTTCCATCTGTATGAGAAGAAT
GTCCATTTCAACCGGGAG
CGCATCCCGCCCCGGTCAGTGCACGAGAAGGGTGCCGGTGCTTTCGGCACCTTCACCGTCACAAAGGACATCTCGAAGTACACAAAGGCAAAG
CTGTTCGACAGGATTGGCAAGAAGACC
GAGATCTTTGCGCGGTGGAGCGTTGTTGCGGGCGAGCATGGGTCAGCAGACTCGGTGCGCGATCCTCGCGGGTTTGCGGTCAAGTTCTACACGGACGAGGGTAACTGGGATCTTGTTGGC
AACAACACGCCCATCTTCTTCATCAG
GGACCCCCTGAAGTTCCCCGACCTGATCCACTCTCAGAAGCGTGATGTGCGCGGCCTGCGCTCCTGGACCATGCGCTGGGATTTTTGGGGCCAC
TCGCCCGAAGCCACCCACCAG
GTGCTATGGCTGATGGGCGATCGGGGTCTGCCCAAGTCGTACCGGCACATGAACGGCTACGGCAGCCACACGTTTTCACTGGTTAACGATAACAACGAG
CGGGTTTGGTGCAAGTTCCATATGAAGTCGGAGCAGGGCAACGAGTCGTATACTGACGAGGAAGGGATTGCGCTGTCCGGAGAGAACCCGGACCTGTTCAACGAGGACTTGTTCACG
AAC
ATCCAGAACGGCAACGGGCCCAAGTGGAAGATGTTCATCCAGGTGATGACGGACAAGCAGGCCGACGAGGTGCCCTACGATCCGTTTGACCTTACCAAGATTTGGCCACACAAGGAGTTC
CCGCTGCACGAG
GTGGGCGAGCTGCACTTCGACCGCAACCCGGTGAACTACTTCCAGGACGTGGAGCAGGCCTCGTTCGCCCCCGCCAACGTCGTGCCCGGCATCGGCTACTCCCCCGAC
CGCATGCTGCAG
GCGCGTCTTTTCTCGTACAAGGACGCGGCAGTCTACAGGCTGGGCATCAACCACGAGCAACTGCCGGTGAACAAGCCCCGGTGCCCGGTGTTCAACTACCACTCAGAC
GGCTTCATGCAGACGCAAAACGGG
GCCGGCCCCCCGTACGAGCCCAACAGCTTCGGCGGCCCCGCCGAGGACGCCCGGTACGTGGACCCGGCCGTGCCCCTGCAGATGAGCGGCGAGGGC
AAGCGGTACAACCACCGGGCGGATTCGGACGACTACTCGCAG
GCGACCGCTCTTTGGCACATAATGAAGCCGGACGAGCAGGAGCGCGTTATCACCGGCATCACTAACACCATGACCAAG
GGCAAGGGCGCCGGGTGTAAATCCGACCCGGTCCCCAAGAAGATCCAGCAGCTGAACCTGTACCACTACTACCGGGTGGATAAGAGCCTAGGGGAGAGGCTGGCCGAGTCTCTCGGGTTG
GATCTGAAGGAGACCATCGCGCGCGCGGAGAAGGACCTTCCCAAGGAGGTGCCCGCGCTTGTGAGCTTGTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAGACGTAGC AAAGCTAGGA CCTACTGAAG CTCGAGAAGC TGAACAAGTT GGCCAGCGCA AGAGACGTGC CGAGGAGGAG TCCGAATACC AGAGGTACCG TTTGCACTTT GCAAAGTCCA  GACTCTCATT CCTGATTAGG TCGTGACAAA AATCAGCGAT CGTCCCACTT TCCACAGGCT GCAGCGCCAA GCAGGAGCTC TTGAATTGGA AGCCTAATCG TGCTCAATAC TTGAGAAGGG  ACCTTATTAG CAACTGCATT GTCCCAGGCA AGGAGGTGGA TTTGCGAAGC AAACGGATCT AAACATTTGT ATGGCCTCCT CAGCAATGGC GTCTCGCGTG GCAGAAAAGG GGCTTCAAGG  ACAATCAATA TTCCAAAGGG TGCAGGATAA CAAGCAGTTT CTGACCGGCA CCGCTTTTGC AGCCCCGCCA GCGTGTCAAG GCTGCGCACA GCTCAGGCGG GAGGCTCGCC AGCAGGCCCC  GAGGGCAGGG CTCTTCAATG GGAATGGAAA GCCGGGAGAG CACTATATCA AGCCAAAGGA GACGCTCACA ACTGCGTCTG GCAAGCCTGT TGGGGACAAC ACAAACAGCA TCACTGCGGG  CAGGAGGGGA CCCCTGCTCT TGGCCGAGGA CTTCCATCTG TATGAGAAGA ATGTCCATTT CAACCGGGAG CGCATCCCGC CCCGGTCAGT GCACGAGAAG GGTGCCGGTG CTTTCGGCAC  CTTCACCGTC ACAAAGGACA TCTCGAAGTA CACAAAGGCA AAGCTGTTCG ACAGGATTGG CAAGAAGACC GAGATCTTTG CGCGGTGGAG CGTTGTTGCG GGCGAGCATG GGTCAGCAGA  CTCGGTGCGC GATCCTCGCG GGTTTGCGGT CAAGTTCTAC ACGGACGAGG GTAACTGGGA TCTTGTTGGC AACAACACGC CCATCTTCTT CATCAGGGAC CCCCTGAAGT TCCCCGACCT  GATCCACTCT CAGAAGCGTG ATGTGCGCGG CCTGCGCTCC TGGACCATGC GCTGGGATTT TTGGGGCCAC TCGCCCGAAG CCACCCACCA GGTGCTATGG CTGATGGGCG ATCGGGGTCT  GCCCAAGTCG TACCGGCACA TGAACGGCTA CGGCAGCCAC ACGTTTTCAC TGGTTAACGA TAACAACGAG CGGGTTTGGT GCAAGTTCCA TATGAAGTCG GAGCAGGGCA ACGAGTCGTA  TACTGACGAG GAAGGGATTG CGCTGTCCGG AGAGAACCCG GACCTGTTCA ACGAGGACTT GTTCACGAAC ATCCAGAACG GCAACGGGCC CAAGTGGAAG ATGTTCATCC AGGTGATGAC  GGACAAGCAG GCCGACGAGG TGCCCTACGA TCCGTTTGAC CTTACCAAGA TTTGGCCACA CAAGGAGTTC CCGCTGCACG AGGTGGGCGA GCTGCACTTC GACCGCAACC CGGTGAACTA  CTTCCAGGAC GTGGAGCAGG CCTCGTTCGC CCCCGCCAAC GTCGTGCCCG GCATCGGCTA CTCCCCCGAC CGCATGCTGC AGGCGCGTCT TTTCTCGTAC AAGGACGCGG CAGTCTACAG  GCTGGGCATC AACCACGAGC AACTGCCGGT GAACAAGCCC CGGTGCCCGG TGTTCAACTA CCACTCAGAC GGCTTCATGC AGACGCAAAA CGGGGCCGGC CCCCCGTACG AGCCCAACAG  CTTCGGCGGC CCCGCCGAGG ACGCCCGGTA CGTGGACCCG GCCGTGCCCC TGCAGATGAG CGGCGAGGGC AAGCGGTACA ACCACCGGGC GGATTCGGAC GACTACTCGC AGGCGACCGC  TCTTTGGCAC ATAATGAAGC CGGACGAGCA GGAGCGCGTT ATCACCGGCA TCACTAACAC CATGACCAAG GGCAAGGGCG CCGGGTGTAA ATCCGACCCG GTCCCCAAGA AGATCCAGCA  GCTGAACCTG TACCACTACT ACCGGGTGGA TAAGAGCCTA GGGGAGAGGC TGGCCGAGTC TCTCGGGTTG GATCTGAAGG AGACCATCGC GCGCGCGGAG AAGGACCTTC CCAAGGAGGT  GCCCGCGCTT GTGAGCTTGT AAAGTTGTAA CAGACGAGTT GGGTTGAAAG CGTGTTGACA TGTACTATAC CAGTTGCTGT GGAAGTAGTG TTACAGGTCG AAGAGCCGAC GTGAAGCCAG  ATTTTGATAG CGCAATCATA GAAGTTCTTG AACTTGTCAA GCTCGATTTG ATACTGAATC TGCGTTGCGG TACGATAATG TGTTCTAATT CACCATTGGC CTGTGCATAT TTGAAGTTGT  GGCTGCCGAG CACGTCTGCC AGATTGCCGA TGAAGGTTTT TCTTCATTGC CTGCAACGCA GTCACAGCAC TCTTGCCCCA CCATACAGAG AAAAGTCGAC TGAGTAGAAC CATTCTTTCA 
AGATGATGTC ACTCATGTGG CCGTCGG 

Retrieve as FASTA