Entry information : KflPrxII01 (kfl00126_0130)
Entry ID 13850
Creation 2016-08-23 (Christophe Dunand)
Last sequence changes 2016-08-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-08-23 (Christophe Dunand)
Peroxidase information: KflPrxII01 (kfl00126_0130)
Name (synonym) KflPrxII01 (kfl00126_0130)
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflPrxII01
start..stop
S start..stop
MviPrxII02 231 1e-79 1..147 1..147
PpaPrxII0501 234 2e-79 2..161 82..243
MpPrxII03 233 3e-78 2..161 150..311
PabPrxII178 228 3e-77 2..161 78..239
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 93043..93114 72 N° 2 93471..93653 183 N° 3 93932..94059 128 N° 4 94277..94379 103
join(93043..93114,93471..93653,93932..94059,94277..94379)


exon

Literature and cross-references KflPrxII01 (kfl00126_0130)
Protein sequence: KflPrxII01 (kfl00126_0130)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   162
PWM (Da):   %s   16970.83  
PI (pH):   %s   4.97
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTIKVGDEIPDATLSYFDSENNMQVVSAKEMVKGKKVVLFAVPGAFTPTCSLKHLPSFIENADKLKAKGVDTIACIAVNDAFVMQAWGKSVGAEGKVLLLADGSGQFAKALGVELDLVDKGLGIRSRRYSMLVDDGKVAALNLEEGGAFSTSGADDILKVL

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACCATCAAAGTTGGTGATGAGATTCCAGATGCGACCTTGTCCTACTTTGACAGTGAGAACAATATGCAGGTGAGAGCTTTGCATTTCTATCAGATATTGTCGTTATGAGTAGTCTTT
TAAGTTTAAGGTTTATTTTCAATCCGTCCTTTCATGCGGCACCAATTGCAGCATTGCGCTTTTAGCACTGCCGAACTGCTGCCAAGCTGTAATGTCGGGTTTGCATAGGAACAAAATCTT
AGAAATGCTGAGGATGTGCACTCCGATCACAGAGACTTCTCCCTGTCATTGATTATTTTTTGAGCATCTCCTTTTCTGCCTGTTGCAACTCAATTGAATCTTGAAAAATATTGATGACTG
CAGAGGAAACGCCAACCAACCGAGATTCGTCTACCAGTTTGAGAGGGATCAAGTCTTATCTACTGCAGGTTGTGAGTGCAAAGGAAATGGTTAAGGGGAAGAAGGTGGTGCTGTTCGCTG
TACCTGGGGCCTTCACCCCAACTTGCTCCCTCAAGCATCTCCCCAGCTTCATTGAGAATGCTGACAAACTGAAGGCAAAAGGCGTTGATACCATCGCGTGCATCGCTGTAAATGATGCGT
TCGTCATGCAG
GCAAGTCATCCGTTTGTGCGGTTGCAGATGGGTTTGATCTTGATCTTAGCGCAGAGTTCCCAACTCGCCATGGACGTCTAGTTTTTGCAATTGAGCACAATGAGAGAGT
GAGAGTATTAATTTGTCACATTCTGGGCATCAGAAGCTTGTCAATGGAGAGTAGTGGTTCCTTGAAAGCCCCTTCCAATCCAGCTTTGATGAAAGCTCTTATAGTGACTGAATGAGATGA
TCAAAGGCAGTTTTTACCTGCTCATGTTCTTGCATTGTTTGCATCACAGGCCTGGGGAAAGTCTGTGGGAGCTGAAGGGAAGGTGCTGCTGCTTGCTGATGGAAGCGGCCAGTTTGCCAA
GGCACTTGGGGTTGAGCTGGACCTGGTGGACAAAGGCCTGGGGATCAGGTCGCGCAG
GTGAGAGGCAATCTAACTCGGTTTTGCATGAATTTTGTACCTTGAGACGTTGCCATCAAGCAG
CATCTTTCTAATGTCAGCCTCTCCCAGGGGGAAGCCTTTTCTGCACCTTCAGTTGGATTTAGAAAAGACTGCGAGAACTTCCCTGAAGTAGATCTGGCTAAATTCGCATCAATCTCCCCA
TATTGCCTGCAAACAGCGATCCATTTCGGTGCAGGTACTCTATGTTGGTTGATGATGGCAAGGTGGCTGCTCTGAACCTGGAGGAGGGAGGTGCCTTCTCCACAAGTGGAGCCGACGACA
TTCTGAAGGTGTTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACCATCAAAGTTGGTGATGAGATTCCAGATGCGACCTTGTCCTACTTTGACAGTGAGAACAATATGCAGGTTGTGAGTGCAAAGGAAATGGTTAAGGGGAAGAAGGTGGTGCTGTTC
GCTGTACCTGGGGCCTTCACCCCAACTTGCTCCCTCAAGCATCTCCCCAGCTTCATTGAGAATGCTGACAAACTGAAGGCAAAAGGCGTTGATACCATCGCGTGCATCGCTGTAAATGAT
GCGTTCGTCATGCAG
GCCTGGGGAAAGTCTGTGGGAGCTGAAGGGAAGGTGCTGCTGCTTGCTGATGGAAGCGGCCAGTTTGCCAAGGCACTTGGGGTTGAGCTGGACCTGGTGGACAAA
GGCCTGGGGATCAGGTCGCGCAG
GTACTCTATGTTGGTTGATGATGGCAAGGTGGCTGCTCTGAACCTGGAGGAGGGAGGTGCCTTCTCCACAAGTGGAGCCGACGACATTCTGAAGGTG
TTGTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGGCTTGCTT CCTTCGGCGC TGGACGGGCT CACTTCCGAT CTGGTTTATA ACCTGTGGAC GTAACCGATG GTTATGTTTT GGACGTAACC GAGCAAGACC AGTCTAGAAG AAGTACCGCG  AGCCTAGCAG TGCAGCGTTC TCATACGGAG GGTTTTCCAC GTTCACCCGT TCAATGTTAA CCAAAATCTT CGTATTTGTG TTCACACGAT CTACCTTGGC TCTGTTCAGG TTGTGCTGAG  TTTGCGATCG ACGCTTTCAC AGCATTCGCA AGCTGCACAG CGCACTTATC AAATCAAGGC ATCCAAAATG GCGGCTTGTG GTGTCTCTAG CTCCTTGGTG TCCTCCGTCC TGAGCACACG  GTCTCTGGCA GCGGCCACCG CCTCCCGTGC ATCTTCTGCT GCATGTGCAG CTTTCCTTCC CGTCCACGCA AGCCCTGCAA ATGTGCGCTC CATTGTGCCT GCAAGCAGAC AATCCGAAGT  TGTGAGATCG AGGTTCTTTG GACAGACGAG CTTTGGTTCT AGGCAGACTA CTTTCCACGG TGCTGCTCTT GCACCAAAAG CAATCCACGG AAGTGCTAGG ACTGCGATGA CCATCAAAGT  TGGTGATGAG ATTCCAGATG CGACCTTGTC CTACTTTGAC AGTGAGAACA ATATGCAGGT TGTGAGTGCA AAGGAAATGG TTAAGGGGAA GAAGGTGGTG CTGTTCGCTG TACCTGGGGC  CTTCACCCCA ACTTGCTCCC TCAAGCATCT CCCCAGCTTC ATTGAGAATG CTGACAAACT GAAGGCAAAA GGCGTTGATA CCATCGCGTG CATCGCTGTA AATGATGCGT TCGTCATGCA  GGCCTGGGGA AAGTCTGTGG GAGCTGAAGG GAAGGTGCTG CTGCTTGCTG ATGGAAGCGG CCAGTTTGCC AAGGCACTTG GGGTTGAGCT GGACCTGGTG GACAAAGGCC TGGGGATCAG  GTCGCGCAGG TACTCTATGT TGGTTGATGA TGGCAAGGTG GCTGCTCTGA ACCTGGAGGA GGGAGGTGCC TTCTCCACAA GTGGAGCCGA CGACATTCTG AAGGTGTTGT AAGCTCGCCT  GGCTAGGACT CTAGTTTCTA AGCATGCCAC AGAGTCCCAC AGTTTTGTCC CTACTAAGCT TGCGTCTTGC GGTTAGACAA TCTGCATGGT GACCCTATTC GATTGGTTAT TTGACCACAT 
CGACAGGTAT TATTTTCCAT CCTACACCGT GGATGCCCTG CACATTTGCA CAAGCCTTTA CGACCCAGGT CGTGCTGATC TGATTTTGGA AGACCAGAGA ATGTCTGCTG CGAG 

Retrieve as FASTA