Entry information : KflPrxII02 (kfl00034_0060)
Entry ID 13851
Creation 2016-08-23 (Christophe Dunand)
Last sequence changes 2016-08-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-08-23 (Christophe Dunand)
Peroxidase information: KflPrxII02 (kfl00034_0060)
Name (synonym) KflPrxII02 (kfl00034_0060)
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflPrxII02
start..stop
S start..stop
HaPrxII05 180 2e-59 1..159 1..162
NtPrxII02a 180 2e-59 1..159 1..162
PpePrxII03 180 3e-59 1..159 1..162
LuPrxII02 182 4e-59 2..159 66..230
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 45329..45449 121 N° 2 46626..46999 374  
join(45329..45449,46626..46999)


exon

Literature and cross-references KflPrxII02 (kfl00034_0060)
Protein sequence: KflPrxII02 (kfl00034_0060)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   164
PWM (Da):   %s   17504  
PI (pH):   %s   5.28
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPLKVGDKLPDGTVKGLDMKDISIKELTSGKKVIIFGVPGAFTPVCSSQHLPGYIKKHDEIKSKGVDTIAILAPNDPFVMKAWAEQYPDSEGKILYLADGTMDYTKKLGFEVDLSGHGLGVRLRRFSLLAEDGVVKELNLEESGGLTTSGADEMCTMLPMAGQ

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCCCCTCAAGGTTGGCGATAAGCTCCCCGATGGCACCGTCAAGGGCCTGGACATGAAGGATATCTCCATCAAGGAGCTGACCAGCGGCAAGAAGGTCATTATCTTTGGGGTCCCT
G
GTAAGCACATGCATGTCTCTTTGAGGACCTATCCTCCATGCAGACCTACAATTGTGGCAGCATGCTCAGCTATGAGGTGTGAGGTTGGGCAGCAACTGGTCTTTTCTAGCGCCACAGCG
AGCATGGATTGGCTGTTCTTGATCTGTCTCATCAATCTGGCGTGTCCGCTCTTGCACCAATTGAGATTGATGCTATGAAGATTGTTTAGGACAGCATATGTCAGCTTGTGTGTTGAATGC
ATTGGAACCTATTGAGGAAACATGAGGGGTCATATGGTGGAAATGAGCTGCGGACATGACTCCCTGAGATTCTTGCTAGGAGTGGATTAGTACGGTCTTTGCGGTTTTGCATTGCTGAAA
GAGACTCTGGGGTGCAAATGGTATGTAAGCATTTCAATCTGCAATTGTCATCGGGCTTTCAACCCGTGCAGCTGAAATACAGTATGTTTGGAGAGCTTAAAACAACTTTCTGAACGTTGA
TATTTTCCAGGGCTGACATGTAGTATGCCTAAATTGAGTCGGCGGTGTTGATTTTTCTCAGAGTAAGTTGTTCAATTTGTTTGGCTGCTTTTAGGGAAACTCCAATTTTCTGCCTTTAAG
TGAACCATGCTTCTCCTTGCATGGAAATGGATCATGTTTGTGCTGGAGTAAGGCAAAGGACTGTCAGAATATGATGGAAGAGTGGTTCTCGATCAGGCTCCTCCGGCCTGCCATGTACCT
CTTGAAACTCTACCCCTTCTCGCCAATTTCAGGTTCGCTCGAGGACCTCGTGAGAATTCTGTTCTTGGAGCTGGAGTTTCTCCAATCTCTTGTTGCAATTTGATAGGGCGCAATTCACAT
CGGGTTTCTGGTCACCGGTGGTGCGTTGGAAGCAGTTATATGTTTCTGTCTTCAGGGAATCTTACCAACCTCTATTCAAACAAACCTTGTCAACCTCTATCCAAGTAAACCTTGCCCTTG
TGCATGAAACGGACCTGCGTAGAACCCTTGAAATTGAGTTATAAAATTGACAGTTGTGGGTTTCGCACCGCCAGACCTACCGTGCGTGTCTCGAAATCTGCTGGCCCCCTCCATCAGTCT
GAAGTCTGTTTGAGGACCTTTTGAAAAGCCGCCGTTGTGTCCTAACCTACTGGAGGTGGGTGAGAAGTGGCTACAACTGTCACGACCATATGCGCAGGTGCGTTCACTCCGGTCTGCTCG
AGTCAGCACCTGCCGGGATACATCAAGAAGCACGACGAGATCAAGTCCAAGGGCGTTGACACGATTGCAATTCTGGCCCCCAACGACCCCTTTGTGATGAAGGCTTGGGCTGAGCAGTAC
CCAGACTCCGAGGGCAAAATCCTGTACCTGGCTGACGGCACCATGGACTACACAAAGAAGCTGGGTTTTGAGGTGGACCTTTCAGGCCATGGTCTGGGTGTTAGGCTGCGTAGGTTCTCG
TTGCTCGCGGAAGATGGGGTTGTCAAGGAGCTGAACTTGGAGGAGAGCGGAGGCCTCACCACCAGCGGCGCCGACGAGATGTGCACGATGTTGCCAATGGCGGGCCAGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCCCCTCAAGGTTGGCGATAAGCTCCCCGATGGCACCGTCAAGGGCCTGGACATGAAGGATATCTCCATCAAGGAGCTGACCAGCGGCAAGAAGGTCATTATCTTTGGGGTCCCT
G
GTGCGTTCACTCCGGTCTGCTCGAGTCAGCACCTGCCGGGATACATCAAGAAGCACGACGAGATCAAGTCCAAGGGCGTTGACACGATTGCAATTCTGGCCCCCAACGACCCCTTTGTG
ATGAAGGCTTGGGCTGAGCAGTACCCAGACTCCGAGGGCAAAATCCTGTACCTGGCTGACGGCACCATGGACTACACAAAGAAGCTGGGTTTTGAGGTGGACCTTTCAGGCCATGGTCTG
GGTGTTAGGCTGCGTAGGTTCTCGTTGCTCGCGGAAGATGGGGTTGTCAAGGAGCTGAACTTGGAGGAGAGCGGAGGCCTCACCACCAGCGGCGCCGACGAGATGTGCACGATGTTGCCA
ATGGCGGGCCAGTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGGACGCGA TTCTCGGGAT CTTCAGATCT GCCAAATACG CAATCAAAAA AGGCTCTGAT TGGTTGGGTT CTCAAAGAAG ATCGCTTCTT TCAGGGTGCA AGCTAGCGGA TGCCAGCAAG  GAAGAAGATC CAAGTCATGC AGCATCCGAC TCGTGCCAGC TTCTCTTTGT CACGACTCCA TCGTGCGCAC CTAACCTTAT CCGATCTCGC AGGAAGGAAA GTAGGTACCC AGTATAACGG  TAGTTCAGTT CGAAGCACAA TCTGTGAAGC CTTTCGTCTT GCTCGCGATC CCTCCCCTCT GTCCGGATTG AAATTTGCGC TGCTTCTCAA TCTCAAAATG GCGCCCCTCA AGGTTGGCGA  TAAGCTCCCC GATGGCACCG TCAAGGGCCT GGACATGAAG GATATCTCCA TCAAGGAGCT GACCAGCGGC AAGAAGGTCA TTATCTTTGG GGTCCCTGGT GCGTTCACTC CGGTCTGCTC  GAGTCAGCAC CTGCCGGGAT ACATCAAGAA GCACGACGAG ATCAAGTCCA AGGGCGTTGA CACGATTGCA ATTCTGGCCC CCAACGACCC CTTTGTGATG AAGGCTTGGG CTGAGCAGTA  CCCAGACTCC GAGGGCAAAA TCCTGTACCT GGCTGACGGC ACCATGGACT ACACAAAGAA GCTGGGTTTT GAGGTGGACC TTTCAGGCCA TGGTCTGGGT GTTAGGCTGC GTAGGTTCTC  GTTGCTCGCG GAAGATGGGG TTGTCAAGGA GCTGAACTTG GAGGAGAGCG GAGGCCTCAC CACCAGCGGC GCCGACGAGA TGTGCACGAT GTTGCCAATG GCGGGCCAGT AGAATCTGGG  TCGTTTGAGT CTTGTTCTGA TCACTGCTGC AGAAAAAACA CGTACTGTTT GACAGCGACT TCTGTATTTT AGCGTCAAAG ATTTTTTAGT TTGTGCTGAA ACACTGGTAG GCAAGACTTG 
CATCCACTTC CAGCGATTTG TGTCTGTGAC GATGGTCTGC TCAAGTGTTC ATACGATCAG TGATTGCATA ACCTTGGCAA CTCATAACAC AT 

Retrieve as FASTA