Entry information : KflPrxQ01 (kfl00014_0230)
Entry ID 13852
Creation 2016-08-23 (Christophe Dunand)
Last sequence changes 2016-08-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-08-23 (Christophe Dunand)
Peroxidase information: KflPrxQ01 (kfl00014_0230)
Name (synonym) KflPrxQ01 (kfl00014_0230)
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflPrxQ01
start..stop
S start..stop
PpaPrxQ01 226 5e-75 100..248 69..217
PpaPrxQ03 222 2e-73 101..250 70..219
SlinPrxQ 220 3e-73 102..250 36..184
NtPrxQ01-1A 218 5e-72 102..250 67..215
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 152138..152446 309 N° 2 151773..151825 53 N° 3 151504..151588 85 N° 4 150971..151060 90
N° 5 150567..150672 106 N° 6 149855..149964 110  
complement(join(149855..149964,150567..150672,150971..151060,151504..151588,1517 73..151825,152138..152446))


exon

Literature and cross-references KflPrxQ01 (kfl00014_0230)
Protein sequence: KflPrxQ01 (kfl00014_0230)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   251
PWM (Da):   %s   26821.02  
PI (pH):   %s   9.84
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTTATPIAASFRLLRHSIAASAAPATKVSPVLSLSAPLCAFSTVKGRVHLRQESFKTSFVAPLSLTGLSSTTVLGGGSFEQLSQYRKMSFLKKLGSRKETSAKLSVGDTVPPLILKDQDGKDFSLGDLRGKSVVLYFYPADDTPGCTKACAFRDSYDTFLKAGAEVVGVSGDSPESHTAFKAKYNLPFTLLSDEGNKTRKEWGIPSDLFGALAGRQTYVIDKDGKIKLVFNSQLNFAKHVTEALAVINS

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGACTGCGACTCCTATTGCAGCTTCGTTCCGCCTTCTGAGGCACAGCATTGCTGCCTCCGCTGCTCCCGCCACCAAAGTTTCTCCAGTACTCTCTTTATCTGCCCCTCTGTGTGCA
TTTTCCACAGTGAAAGGAAGAGTTCACTTGAGGCAAGAGAGTTTCAAGACGTCTTTCGTTGCACCACTTTCTTTGACAGGGCTTAGTAGCACCACAGTCTTGGGAGGAGGGAGCTTTGAG
CAATTGTCACAGTATAGAAAAATGTCGTTCTTGAAGAAACTGGGGAGCAGGAAGGAAACATCTGCCAAA
GTAAGCAGATTATTATCTTACTTGGAGACTAACAGGGGGAATGAAGGCTCT
TCTCCGTTCAGGACCTTGATACTACTGATTTTTGGTTGTGATGGACATTTACATCAGTAGTGTTCGTGGCATGAGGTGTTATGTGGCAGGTTTCTCTTCAGAACTCTCTCACATTGACTG
GTTTGAGTGCTCTACTGTAGTCCACAAAACACTCGATTATGTGTCCTCTGCGATGATGTGTGGCTCCTCTCTTCTTTCTTGTCAATGTAGCAAGGATCAGCTTGCTAAATTGGCGCTTGA
AACCTGGCTTCTTTTGTGCAGCTCTCTGTTGGTGACACCGTCCCCCCGCTCATCCTGAAAGATCAGGATGGAAAGTAAGTTGCATCATGGCTCACCCTCTATCATAGGCGCTATATATTT
GTAGAAGTCTGCCCTCTGATGCTGCAGAATGCACGTATGAGCAACCATCCTTTCCATCAAAACATGTCAGGATCTACGTGAAACAGGCTCTAGGGTCTGCTGTGCAACCTATGAGTGACC
CCTCTGTTATATTCACAGGGACTTCAGTCTGGGTGATCTGAGGGGAAAGAGTGTTGTCCTATACTTTTACCCAGCAGACGACACCCCTGGATGCACAAAGGAGGTAGGCCCCATGTATCA
TTTCTGGACCTTCATTGGTTAGTTTCTGAGTTCACAACTGCTTAGCGCAGCTGCTTTCCCATCTACTTGTGAGTATTGAATTCACTTTTGACTTTTGAGCTAAGCAAGTGTAGATTGCTA
CGAAGACTTTACAGAGCCTCTCATGAAGTGGTCAGTCTGCTATTTAGTTGAAAAGAAGGGGAGCTGTTTGAGTGAGATTTGATTGGATGAAAGTCCGGACGAGGCGTTGTAAAGTCAGTG
TAGTCAAAGACAAGGCGTTCAAATCGGTAGTCACACCTCACTCGTAGATCCCAACAACGTGCAATTTTGGGAAAGGGCAATCTGGCTGTTGTTCGTGTCCCATTAGGACCGTGGACAGTC
TACAAGTATCTGTTGTAGGAGTCACTCCATTGTGCAGTAACTCAACCTGGGTTGCTTTTCTTGCAGGCGTGCGCCTTCCGGGACTCCTATGATACTTTCTTGAAAGCAGGGGCTGAGGTC
GTCGGTGTCAGTGGCGACTCTCCAGAATCTCACACG
GTGCGGAGATACATCAACAAAATGGGGTTTTTTACCTTTTCAGCTCTGTGACGTCCTCACAGGAACGCGATCCGTGCTTGACTG
ACCGATGTCTCTCTGCCACCCCGTGTCATTCGCTTCACTCTTTGATTCCTGTTCCTTTTTCATACCTGCACAGAGTCTGCCTGTTCCAGTATCTACTGCACAAGCTGGCGGACGAGGATG
AGCACGAAGCCGAAACGGATTCTCATCCTTCAGTAGCACCTCAGGAGTGGAGGATAGCATAGAATCGGTACAAGAGGCCTTGTTTGCCTTGCAGGCGTTCAAGGCCAAGTACAACCTGCC
CTTTACCCTGCTCAGCGACGAGGGTAACAAGACCCGCAAGGAGTGGGGCATCCCGAGCGATTTGTTTGGAGCGCTGGCAG
GTGCGCCTTCTTGTCCAGACAGTCAAGCCTGTAGAGAAAT
TCGTTTGCACTGGCGATAGCAGGCGACCCATAATACAGGTCCACCTCTCCGACAGTGGTCGAGCATCCGAATACGACCCAATACTCTCGCCCGCTGTTAGAAAGGCCTCCTCTGTAGAAA
TGGTCCATGATTCTTCTTTCTTATTCAGAAAAAACGAATCAACCATGTCTTTCCGGAGCTCTGGTGCAGCCAAAGTCGACGAGTTCTTGGTTTCTGAATGCTAATCCAACCATTCACTTC
CGAAGTCGTTGAGTGTTAGCAGGTTTGAGCGTAGACTGTTTTGTTTCCGTAAGCTTTGCGGCAATATATCATTGCAGCTGGTCGAGGTCAGAGACTTGTTGCTGAGAATGGTGTTCGTAT
GATGGTTTCGTTGCCTAAAAGGGTAAGTCACCGAGAGGTCCCTTGTCTTTCCGACCCCCTTCGGAGTTCGATGAGAAGACTTGTGGGCTAAGAAATCCTTAGGAAACCAGTGGCCTGCGA
CAAACATTCCTCTACTGAACAAGACGCCCTGTTTGTGACCCCCATAGTTGCAGACGCGCTGATCAATCTGTTATCCTTCCAGGTCGGCAAACGTATGTCATCGACAAGGACGGAAAGATT
AAGCTTGTCTTCAACAGCCAGCTCAACTTCGCAAAGCACGTGACGGAGGCTCTTGCTGTGATCAATAGCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGACTGCGACTCCTATTGCAGCTTCGTTCCGCCTTCTGAGGCACAGCATTGCTGCCTCCGCTGCTCCCGCCACCAAAGTTTCTCCAGTACTCTCTTTATCTGCCCCTCTGTGTGCA
TTTTCCACAGTGAAAGGAAGAGTTCACTTGAGGCAAGAGAGTTTCAAGACGTCTTTCGTTGCACCACTTTCTTTGACAGGGCTTAGTAGCACCACAGTCTTGGGAGGAGGGAGCTTTGAG
CAATTGTCACAGTATAGAAAAATGTCGTTCTTGAAGAAACTGGGGAGCAGGAAGGAAACATCTGCCAAA
CTCTCTGTTGGTGACACCGTCCCCCCGCTCATCCTGAAAGATCAGGATGGA
AA
GGACTTCAGTCTGGGTGATCTGAGGGGAAAGAGTGTTGTCCTATACTTTTACCCAGCAGACGACACCCCTGGATGCACAAAGGAGGCGTGCGCCTTCCGGGACTCCTATGATACTTTC
TTGAAAGCAGGGGCTGAGGTCGTCGGTGTCAGTGGCGACTCTCCAGAATCTCACACG
GCGTTCAAGGCCAAGTACAACCTGCCCTTTACCCTGCTCAGCGACGAGGGTAACAAGACCCGC
AAGGAGTGGGGCATCCCGAGCGATTTGTTTGGAGCGCTGGCAG
GTCGGCAAACGTATGTCATCGACAAGGACGGAAAGATTAAGCTTGTCTTCAACAGCCAGCTCAACTTCGCAAAGCAC
GTGACGGAGGCTCTTGCTGTGATCAATAGCTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCTAGAGGCT ATGCATGTAC AGCTAGACTT TTTATGCACA TGTGGCGTCC ACGCTGGACA CTTGCTGCGG CAGATCTTGC TAGCTTCGAT TTCTGCCAAG ATGACGACTG CGACTCCTAT  TGCAGCTTCG TTCCGCCTTC TGAGGCACAG CATTGCTGCC TCCGCTGCTC CCGCCACCAA AGTTTCTCCA GTACTCTCTT TATCTGCCCC TCTGTGTGCA TTTTCCACAG TGAAAGGAAG  AGTTCACTTG AGGCAAGAGA GTTTCAAGAC GTCTTTCGTT GCACCACTTT CTTTGACAGG GCTTAGTAGC ACCACAGTCT TGGGAGGAGG GAGCTTTGAG CAATTGTCAC AGTATAGAAA  AATGTCGTTC TTGAAGAAAC TGGGGAGCAG GAAGGAAACA TCTGCCAAAC TCTCTGTTGG TGACACCGTC CCCCCGCTCA TCCTGAAAGA TCAGGATGGA AAGGACTTCA GTCTGGGTGA  TCTGAGGGGA AAGAGTGTTG TCCTATACTT TTACCCAGCA GACGACACCC CTGGATGCAC AAAGGAGGCG TGCGCCTTCC GGGACTCCTA TGATACTTTC TTGAAAGCAG GGGCTGAGGT  CGTCGGTGTC AGTGGCGACT CTCCAGAATC TCACACGGCG TTCAAGGCCA AGTACAACCT GCCCTTTACC CTGCTCAGCG ACGAGGGTAA CAAGACCCGC AAGGAGTGGG GCATCCCGAG  CGATTTGTTT GGAGCGCTGG CAGGTCGGCA AACGTATGTC ATCGACAAGG ACGGAAAGAT TAAGCTTGTC TTCAACAGCC AGCTCAACTT CGCAAAGCAC GTGACGGAGG CTCTTGCTGT  GATCAATAGC TGAGCTTGTC CTATGAGATT AGCTTTACAA GATTCTGGTC GTCAAATACG GGGGGCAGTA GGGTTCCGCG CAGAAGAACG GATCGTCAAA CTTGGGATGC AGTAAACATC  GACTTGAATA TGGAGGTAGA TCTAGCCGAA CTCGAAGATG TTGTAAGGCT GAAAGCCTAA AGCTGTCTTT GAAGTCGAAG CTCACTGGCA TGCATTGACT GCTGTGAATA TATTGATTGC  ATTGCTTTGC TAATGTAGAA GCTTGATTCT GGGAGGCTCT AAGTATATTA GGAACATTAT AACATTGAAC CCTATAAGAT AGATCTGGTT CAGTGCTTTA GATGCACGGC GCCAGTCTGT  GTATAATCCT CATTTGAGGT GAGTCTGGGC ATGCCGCAGT CAGAACCTGA GCTGCAGTGA ACGGCCACAT ACGTAAGCTC AAGCACATAT ATACGGCAGC CGTGGCCACG GTCAGTAAGA 
AATAGCA 

Retrieve as FASTA