Entry information : KflPrxQ03 (kfl00291_0160)
Entry ID 13854
Creation 2016-08-23 (Christophe Dunand)
Last sequence changes 2016-08-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-08-23 (Christophe Dunand)
Peroxidase information: KflPrxQ03 (kfl00291_0160)
Name (synonym) KflPrxQ03 (kfl00291_0160)
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflPrxQ03
start..stop
S start..stop
PulPrxQ 146 4e-43 2..175 29..197
PulPrxQ 125 4e-35 19..175 224..376
PsojPrxQ 139 1e-40 3..173 20..189
PsojPrxQ 124 4e-35 11..171 203..357
PparaPrxQ_P1569 137 6e-40 45..173 61..189
PparaPrxQ_P1569 123 1e-34 4..171 190..357
PraPrxQ 137 8e-40 5..173 21..190
PraPrxQ 119 7e-33 36..171 225..356
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 82675..83052 378 N° 2 83378..83424 47 N° 3 83864..83966 103  
join(82675..83052,83378..83424,83864..83966)


exon

Literature and cross-references KflPrxQ03 (kfl00291_0160)
Protein sequence: KflPrxQ03 (kfl00291_0160)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   175
PWM (Da):   %s   18667.84  
PI (pH):   %s   9.97
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPKRKAAAAAKEEAAPTKKGKGGLAIGDDFPNLPELEFDESTPEEKKTVKLSDVLKDHGIILFFYPKANTGGCTKQACGFQDNLSEIEKAGYKVFGMSADKPKSQAGWKAKRGFKYNLLSDPSYEVLKTLGVTKGAKSISRSHIVVEKGGKIKDVRIGISPGDSFAEALKTVTA

Retrieve as FASTA  
Remarks Complete sequence from genomic. Match with oomycetes and fungi PrxQ (LGT)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCCCAAGCGGAAGGCTGCAGCGGCAGCAAAGGAAGAGGCTGCTCCCACAAAGAAAGGCAAGGGAGGGCTAGCGATTGGCGACGACTTTCCCAATCTGCCTGAGCTAGAGTTTGAT
GAATCCACGCCGGAAGAGAAGAAGACCGTCAAGCTGAGTGATGTCTTGAAAGACCATGGCATCATCCTCTTCTTCTACCCAAAAGCAAACACTGGGGGCTGCACAAAGCAAGCCTGCGGG
TTCCAGGATAATTTGTCTGAGATTGAAAAGGCAGGGTACAAGGTGTTTGGAATGTCTGCAGACAAGCCAAAGAGTCAAGCGGGCTGGAAAGCCAAGCGAGGCTTCAAGTACAACCTGCTG
AGCGACCCCAGCTACGAG
GTCAGTGTATTGCCCTGGTAAACTGTTCTCGAGATAGTTTACCATTGCGTGCCAAGATGGCCTTTTAGTCTTTAGATACTTTCCCCCTCCCCAGCTACGCAG
ATGTGTCGGACAATGTGCAATGCTGCAGATCATCAGCCAGCACTTCAATCAACAGAGACCAACTTCAGGGACATCAAATATGGTGGAACTCACACGAGCAGTTTCAAATGTCCTGAGGAA
TATTTACCTGCTTGAGATCAGCAATGTTGTTGTGCCCTTGATTTGTTGCAAGTACCCTTGATTCTCCCCTGTTGACACTTATTGACGCCATTGCCCTTTTCAGGTGTTGAAGACTCTTGG
AGTGACCAAGGGTGCCAAGAGCATAAGCAG
GTAAGCTTCCATCACATTCCGAAGAAGCAATCTTGGTGGGTTCGATCTATGGACCTGCCTGTGGAACTACTGTAGAGCCATTGCCCCCAC
TGATCACAGAAAACCCCTATACCAGTACACAATCTCAAGGCTTCTAGTAGGGTAGTAGGGATGGCAGCGTGACTTCTATTGGTCAAGACGCAGGCAACACAAGCACTGGTAAAGCAAGCA
GAAGACTTTGCGGGAACATGGTCAAAGAAAATACCTGATCAAGGTTGCAAAGGCTACTTATCGTGTTCCCCATCAGCGGGCCCCGCCGGATAAGCTGCTTCATTTGAGGGGATTCCAAGC
CGTTGAAGGGGCTTTTCAGTCCAGAATGTCTTGCGTGCCTGCACACTGTTGCATCTGATTAGTGGCCCAGACTTGTCCTCCTGCGGATCATTTCTTTTTGTGCTCGCAGGTCGCACATTG
TGGTCGAGAAGGGAGGAAAGATCAAGGATGTCCGCATTGGCATCAGCCCTGGCGACAGCTTTGCAGAGGCGTTGAAGACAGTGACAGCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCCCAAGCGGAAGGCTGCAGCGGCAGCAAAGGAAGAGGCTGCTCCCACAAAGAAAGGCAAGGGAGGGCTAGCGATTGGCGACGACTTTCCCAATCTGCCTGAGCTAGAGTTTGAT
GAATCCACGCCGGAAGAGAAGAAGACCGTCAAGCTGAGTGATGTCTTGAAAGACCATGGCATCATCCTCTTCTTCTACCCAAAAGCAAACACTGGGGGCTGCACAAAGCAAGCCTGCGGG
TTCCAGGATAATTTGTCTGAGATTGAAAAGGCAGGGTACAAGGTGTTTGGAATGTCTGCAGACAAGCCAAAGAGTCAAGCGGGCTGGAAAGCCAAGCGAGGCTTCAAGTACAACCTGCTG
AGCGACCCCAGCTACGAG
GTGTTGAAGACTCTTGGAGTGACCAAGGGTGCCAAGAGCATAAGCAGGTCGCACATTGTGGTCGAGAAGGGAGGAAAGATCAAGGATGTCCGCATTGGCATC
AGCCCTGGCGACAGCTTTGCAGAGGCGTTGAAGACAGTGACAGCTTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCCACATGGT GGAACGTGCT CGCAATGCTA GGGCATTTTG CAGCTCTGAT CGATTGGCTC TGTTCGCAGT CACAAGTCCT CAAGAAGTCG GATTAAATTG TGACCTGGAT AAGTGAATGC  TGCAGCTCGG TGCCGGCAGA TCTACGCGAA ACAGTTGCCT TGCAAGAAGA GAAGAGGGAA AGCAGCACTT TCACTAAGTT TGCTAATCAA TGGCGCCCAA GCGGAAGGCT GCAGCGGCAG  CAAAGGAAGA GGCTGCTCCC ACAAAGAAAG GCAAGGGAGG GCTAGCGATT GGCGACGACT TTCCCAATCT GCCTGAGCTA GAGTTTGATG AATCCACGCC GGAAGAGAAG AAGACCGTCA  AGCTGAGTGA TGTCTTGAAA GACCATGGCA TCATCCTCTT CTTCTACCCA AAAGCAAACA CTGGGGGCTG CACAAAGCAA GCCTGCGGGT TCCAGGATAA TTTGTCTGAG ATTGAAAAGG  CAGGGTACAA GGTGTTTGGA ATGTCTGCAG ACAAGCCAAA GAGTCAAGCG GGCTGGAAAG CCAAGCGAGG CTTCAAGTAC AACCTGCTGA GCGACCCCAG CTACGAGGTG TTGAAGACTC  TTGGAGTGAC CAAGGGTGCC AAGAGCATAA GCAGGTCGCA CATTGTGGTC GAGAAGGGAG GAAAGATCAA GGATGTCCGC ATTGGCATCA GCCCTGGCGA CAGCTTTGCA GAGGCGTTGA  AGACAGTGAC AGCTTAGATT CAACCATAGG GGAGACAGTC AAGTGCTTGA CCGGGCCAAC ATGCTCTGTT TGAGAGAAAC GTTCTGGAGT TGCTCCAATC GGGGCTTGTC GTCCAGAACT  TTGTGGACCT AAATTGTTTG GGGTCTGGCC AGGCCAGCGA CTGGCCTGCC GGCCTTGATG AGACACTCGC GTTGTAGCTG TGCCACAGAT CTCGAGTCGA TTGTGTTGGC GAGCTTGCCC  AATCACTCAT CGGTCAGAAA CTTATACGGA GTTGTATAAT TAGTTGGGAG TGGACTGCTT AAAATTACTC AGAAAGTTCA CAAATTTTCT GCATGCTTCC AACGAGGGCA GGGTGCACCT 
GGTCGGAGTT TCCGACTCAA CTTACCTCCA GATCAAACTG GCCGCGCCTA CGCCACACCG GGGACCACCT GAGCACGTTG C 

Retrieve as FASTA