Entry information : KflGPx02 (kfl00026_0550)
Entry ID 13856
Creation 2016-08-23 (Christophe Dunand)
Last sequence changes 2016-08-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-08-23 (Christophe Dunand)
Peroxidase information: KflGPx02 (kfl00026_0550)
Name (synonym) KflGPx02 (kfl00026_0550)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflGPx02
start..stop
S start..stop
CpslGPx01 234 5e-78 37..250 16..238
ZaGPx04 214 3e-70 25..250 4..242
AfpGPx01 214 5e-70 92..250 76..237
LuGPx140 212 4e-69 44..250 31..242
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 336195..336545 351 N° 2 335198..335260 63 N° 3 334210..334548 339  
complement(join(334210..334548,335198..335260,336195..336545))


exon

Literature and cross-references KflGPx02 (kfl00026_0550)
Protein sequence: KflGPx02 (kfl00026_0550)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   251
PWM (Da):   %s   27178.95  
PI (pH):   %s   9.49
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSTAAAYQVSFSVGSTALRGASSRSACKAAALAPVASLCPLQAESNRLVARSTQLSSSFVSSKEDLRAEFRLQQSAQRRHFSNRVGVKTALTMAASSAYDFSVKDIDGNETDLSKFKGKVSLIVNVASACGLTKQNYQELTTVYDKLKEKDFEVLAFPCNQFGGQEPGSAEEIKKFAGDKYKATYPLFSKVDVNGAKAEPLFQYLKKEAGGGDIAWNFGKFLVDKDGKVVKRFDPRTNPSAIEQEIEKIL*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCACGGCTGCTGCTTATCAGGTTTCCTTCTCCGTTGGCAGCACCGCCCTCAGAGGTGCAAGCTCGCGTAGCGCTTGCAAAGCCGCTGCTCTTGCGCCCGTTGCCTCTCTTTGCCCT
TTGCAGGCTGAGAGCAACCGCTTGGTTGCGAGGAGCACACAACTTTCATCGTCGTTTGTTTCGTCCAAGGAGGATCTGAGGGCTGAGTTTAGACTGCAGCAGTCTGCCCAGAGACGGCAC
TTTAGCAACAGGGTGGGAGTGAAGACTGCACTCACCATGGCCGCCAGCAGTGCCTATGACTTCTCGGTGAAGGACATTGATGGCAACGAGACGGACCTGTCAAAGTTCAAG
GTAAGACCA
AAGACAAGCGCCCAGGCAAGGATCTGTTGGTCATTCTGGATGTTGCAAGCAAGAATGAATGCATGGATGCAATTGTCTTTATTCAGAGACCAAAAGATTCAATAAGATGTGGTTCCATTT
GTATGCAGCATCATAAGTGCTTTAGGCAACCTGATTGCGAGCCTAATGTCATCGATCAGAAAGGACAAGGCCAAACTTGATTGGGCAGGTTAATTCCATTACTTTCTGGTTGGATGAATC
GAGTACTCCAAGCTTCATTCATGATTTCTCCGTCCTGAGAGCTTCCCGCTCTTTTCCTGTACTCTCACAGACGAGGGTGCGACTTTCAAACAATCATTTCGCCAAAATGTTGCCCTTGGT
TTTCACCCCAACAATGCTGCTTCGGAGGCCCTCCCCTTTACTTTGAGTTGTGCATTAATCCGATCATCATTTACTTGGAGAGCTTGGAAACTACTAGTTATCAAGCTTGCGGACAACATT
CTGAATTAGAGCAACTTGAGGAGCACTGAATTCAACTTCCGTGAGCAAGTTCTAGATGGGTATGGTCGGCACTTAGAGCAGGGGCATTGTCATTCCTCCTGCTTCTGTCGCAGGTAGACA
CTCTTCTCTTGTGTGATGTTGTGCCTGTGGAATGGCAGGGTTTGATGGCAAGATTGTGACAATCATACGTGTGATACACTCTACTCAGCTGGAACCCAAAAGCTTCTGCCATCATTGGTC
TGCCTAAGCACAGCCACATTGTTTGTGACCAGCTGTTTACTTTGTGGTCATGTTTCTTTCCCCAAGTTTCACACTGCCAATTAAAAGCCATACAGGGGCCAGCCAGCAGGACAGTAGGCC
GCAAATGGAGCTGCTTTTCGAATGGAGAACGCTTGAGTACTGGTGGTTATCTGACATTGACGCACCGGTAGTTTCCTGTGTGCAGGGGAAGGTTTCATTGATCGTGAACGTCGCCTCCGC
ATGCGGTCTCACCAAGCAAAACTATCAG
GTAAGTTTCCGTCTTTGTTCACTCTGCGCAGTACTTGCGTGGATTTTAACCAATTGGTCTCTTCAATCACTCGAAGCTGTATATGGATATAT
TGCTGGAGTCTTTCCATGCCCCTTAAAGGCTTGGCCCGCAACATGAAAGAAGGCTTAAAGCGGTCCACTTTTGATCCAACACTGTCTGCTTAAAAGTAGCAGGCATGGGACATACTCATA
AGTCGTAGACTGGCCATTGACGTTGCAAAGGGAACAGTGCCACTTGGACTGTATATCATAAGTTGAAGTAAAATTGCTAAACCGCTTGAGAACAAAGTATTCGTTGAGCACGTTTCAAGC
CTATTTTGGAGTATGTCTCCAGACGAAGTGCCCCTTTAGTGCGGAGCAGGGTACGCACTTTTGGTGTCTTTGATAGCTGGTGTCAATTGATAGCTGCCAGCGGGTTGCCCTTGAAGCTGC
TTCTTGGAAACTCTTTCAGAATCTGCCACCTCTTGGTGCGACTTGGAGGAGGCTCGGCGCGATGTTACTGAGGTTCGGCTTCTTTCACTGTGGGCCAAGTCACCATCAATTTTGCTTCTG
CAACTTCAGAGATTCACCAAAGCAAAGATGACATTTTGAGCAGGAACGCCAGTTTTAACTGGGTTGCTTGTTTACAGGAGTTGACGACGGTTTATGACAAGCTCAAGGAAAAGGACTTCG
AAGTGCTCGCCTTCCCGTGCAATCAGTTTGGGGGCCAAGAGCCCGGCTCTGCTGAAGAGATCAAGAAATTTGCAGGGGACAAGTATAAGGCAACTTATCCTCTATTCTCTAAGGTTGACG
TCAATGGGGCCAAGGCCGAGCCCTTGTTTCAGTACTTGAAGAAGGAGGCTGGGGGTGGAGATATTGCGTGGAACTTTGGCAAATTTTTGGTTGACAAGGACGGGAAAGTTGTCAAGAGAT
TCGATCCCAGGACGAATCCATCGGCCATAGAGCAGGAGATTGAGAAGATCTTGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCACGGCTGCTGCTTATCAGGTTTCCTTCTCCGTTGGCAGCACCGCCCTCAGAGGTGCAAGCTCGCGTAGCGCTTGCAAAGCCGCTGCTCTTGCGCCCGTTGCCTCTCTTTGCCCT
TTGCAGGCTGAGAGCAACCGCTTGGTTGCGAGGAGCACACAACTTTCATCGTCGTTTGTTTCGTCCAAGGAGGATCTGAGGGCTGAGTTTAGACTGCAGCAGTCTGCCCAGAGACGGCAC
TTTAGCAACAGGGTGGGAGTGAAGACTGCACTCACCATGGCCGCCAGCAGTGCCTATGACTTCTCGGTGAAGGACATTGATGGCAACGAGACGGACCTGTCAAAGTTCAAG
GGGAAGGTT
TCATTGATCGTGAACGTCGCCTCCGCATGCGGTCTCACCAAGCAAAACTATCAG
GAGTTGACGACGGTTTATGACAAGCTCAAGGAAAAGGACTTCGAAGTGCTCGCCTTCCCGTGCAAT
CAGTTTGGGGGCCAAGAGCCCGGCTCTGCTGAAGAGATCAAGAAATTTGCAGGGGACAAGTATAAGGCAACTTATCCTCTATTCTCTAAGGTTGACGTCAATGGGGCCAAGGCCGAGCCC
TTGTTTCAGTACTTGAAGAAGGAGGCTGGGGGTGGAGATATTGCGTGGAACTTTGGCAAATTTTTGGTTGACAAGGACGGGAAAGTTGTCAAGAGATTCGATCCCAGGACGAATCCATCG
GCCATAGAGCAGGAGATTGAGAAGATCTTGTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGCTGCCAGC GAAGGTGGTC GTGAAGGTTG CAGCATCAAT GGCTGTACAA CTCCGAGTAC AACGTCACAA TTTCTCTCCA GCATTCCTTC TTGCCGCCCC AATCATGTCC ACGGCTGCTG  CTTATCAGGT TTCCTTCTCC GTTGGCAGCA CCGCCCTCAG AGGTGCAAGC TCGCGTAGCG CTTGCAAAGC CGCTGCTCTT GCGCCCGTTG CCTCTCTTTG CCCTTTGCAG GCTGAGAGCA  ACCGCTTGGT TGCGAGGAGC ACACAACTTT CATCGTCGTT TGTTTCGTCC AAGGAGGATC TGAGGGCTGA GTTTAGACTG CAGCAGTCTG CCCAGAGACG GCACTTTAGC AACAGGGTGG  GAGTGAAGAC TGCACTCACC ATGGCCGCCA GCAGTGCCTA TGACTTCTCG GTGAAGGACA TTGATGGCAA CGAGACGGAC CTGTCAAAGT TCAAGGGGAA GGTTTCATTG ATCGTGAACG  TCGCCTCCGC ATGCGGTCTC ACCAAGCAAA ACTATCAGGA GTTGACGACG GTTTATGACA AGCTCAAGGA AAAGGACTTC GAAGTGCTCG CCTTCCCGTG CAATCAGTTT GGGGGCCAAG  AGCCCGGCTC TGCTGAAGAG ATCAAGAAAT TTGCAGGGGA CAAGTATAAG GCAACTTATC CTCTATTCTC TAAGGTTGAC GTCAATGGGG CCAAGGCCGA GCCCTTGTTT CAGTACTTGA  AGAAGGAGGC TGGGGGTGGA GATATTGCGT GGAACTTTGG CAAATTTTTG GTTGACAAGG ACGGGAAAGT TGTCAAGAGA TTCGATCCCA GGACGAATCC ATCGGCCATA GAGCAGGAGA  TTGAGAAGAT CTTGTAGGGC ATGGAAAGGA GGACAACGCC GTCGTCACTT TCTATATGCC ATTTTATCAT CTACTGAATG CACCTTTGTT GGATGTATGG GGTAATCCAA GGTAACTCGA 
GCCATGTAAA TAACCGCATG TAAAGCCGGC CCAACTTTTT ATCACGC 

Retrieve as FASTA