Entry information : KflCCS01 (kfl00631_0040)
Entry ID 13858
Creation 2016-08-23 (Christophe Dunand)
Last sequence changes 2016-08-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-10-20 (Christophe Dunand)
Peroxidase information: KflCCS01 (kfl00631_0040)
Name (synonym) KflCCS01 (kfl00631_0040)
Class Copper chaperone for SOD    [Orthogroup: CCS001]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflCCS01
start..stop
S start..stop
MpCCS01 254 2e-84 13..247 114..357
ThasCCS01 239 1e-78 26..250 85..314
AtCCS01 233 1e-76 26..247 83..310
HaCCS01 228 1e-74 28..253 81..312
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 14100..14162 63 N° 2 14523..14552 30 N° 3 15257..15329 73 N° 4 15918..16052 135
N° 5 17792..17994 203 N° 6 18401..18658 258  
join(14100..14162,14523..14552,15257..15329,15918..16052,17792..17994,18401..186 58)


exon

Literature and cross-references KflCCS01 (kfl00631_0040)
Protein sequence: KflCCS01 (kfl00631_0040)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   253
PWM (Da):   %s   26607.48  
PI (pH):   %s   4.69
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSGVRAGIPSRMVRAEAATAEASAEAAPELVTEFMVDMMCEGCATSVRNKLHPLPGVTDIRTSVSDQTVRITGTESLKSLQKALEETGRANRLIGQGSLEEFEISAAVAEFKGPVVMGVLRIAQVTKDTARVEGQFDGLKPGPHAVFLNQYGDLTRGAASTGGIYIDGREAGFLGIANADETGHAELPTAVVQLRVYDLIGRALVISESDKVSTENAFASVVARSAGVGQNLKNLCSCDGTVIWEAQQDRVS*

Retrieve as FASTA  
Remarks Copper/zinc superoxide dismutase
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTGGGGTCAGAGCAGGAATCCCATCTCGGATGGTCCGGGCTGAGGCGGCAACTGCGGAGGTAAGCCAAGCAGCGGTTTCGCCCTTGTCGCTGTTTAGATTGTTCGGAACACCACGA
AATTACATAGTCTATCAGAAGATTTTTGTGATAGGGGGCAGAGTGTCCAGACAAGACATTGTATCTTGGAAGATGAACTTAAGTGCAGAAGCGCCACATCGATTGGCTAAGGAGTTGCGG
CTATTGCTCTGGATAGCTTGACTGATCACCTGCATGGGTTGACCTTCTGCAGAATCTGGAGGGGAACTTGGCGACACTTTTAGATCGTCCGTAGGACAGTAGTGTATAAGCCGTTGTTTG
CAATCTGTACTGCACCCCTGCTTAGGACTATCTCTTAAAGATTGAACCTTGTGTACTGTGCAGGCAAGCGCTGAAGCTGCACCGGAGTTAGTGGTAAGCGGCAAACTATGTTTCATGGAA
GCTGACTTTCAATTTTTGCTGATTGCTTGGTTGATTTCGTTGGTCTGGTGTTTTGATCGAACAAGGGTCTTGTGCAAAAATACCCCCGCGTCAGAACACGCTTGCAGTGGACATGCCCAT
TGAAGGTCGCCCCGTGAACTTCTGCAATGAGAATGATTTTCAGGATGTGCATCTCAGTTGCCCAGTCTGCACCCCGCGCTTCTGTGTAACACTGGCTTGGATGGTATTGTAAGAACGTGA
GACATTTTCATCTGTACATGAAGATAGTCTCAGTGAACCGACTGTCAACCGGTAGAGACTTCTAATGTGCTTCTGGGACAGGTCCCTCTACCTTCAGAAGAATAGTAGGCCATAAAGTTT
ACAAAGAAATAAATTGAGTCAATTAATTCACATGTTTTGAGAAGTGTGGGTCTTAGTGGGGCTAGCGTGACATACAAGTTTCGCTTTCATGTTATCTTAAGGGCTATGTTGAGTCTCCGC
AGTTCCTTTCTGTTTTGCACAAAGTAAAACCTAGATGAGATCGACATGCTCTGCAAGCGTGCCCGCTCTAAGCCCCCAAACCAAAACCACTGATCGCTTAGGCAGTGACCTGATTCAAGA
TAGCCGTAACTAATCAAATTCGAATTCACTGCGTGATATATGAGACCGTGAGTTTTGGTGGGGCCTTGTGTGTACAGACTGAATTCATGGTGGACATGATGTGCGAGGGGTGCGCCACCT
CGGTCCGCAACAAGCTGCACCCACTGCCAG
GTAATCCCACGCAGCCCTGCATTTTGTGTGAAGGCCAGTTTACATCACTTTTAGCTTGCGAATCCACTTTCTGATTGAAGATGAATTGTA
GGCAGAGGAGGCTTACATCTATGTCTCTCTCAAAAATGGAATCTGCTTCGTGCGCTGGAACTGAAGGATGAGAGGAACTGTGTCTAGTAAAGTTTCCTGGGACTGTCTTTGTAGTCACTA
AAAGTTTGGAGAATGGAACAAGCTGCTTCGGCGAGTCACGGAAAACAGCATGTCTTAGTGGGGGGAAGCAAAAGATTTCGAAGATTGGATTTCGGCTGGTCAGGATCACAAATATAGTTA
GTTTGCGTGATGAAATCAAGCGTCTCAAGGCCAAGCGGTAGCGTAAGTAGATCTAACAAAAGGCTGTCTTTACAGAGAAGACGCTTCGTAAGAATAATGAGAAGCTTGGAAGTAAATTTG
CTCAAAGAAGTTGATTGCTTCGGAAGGGCAACGATGAATCGAATCCTTTTTCCCCTGTAGGTTTGGCAACCTGATCGTGGTGTTCTATCGGGCAGCGAACTTGCATTATTTTTGACATGG
TCTGCCGTCGATTGGCAGGTGTGACTGACATCAGAACGAGCGTGTCGGATCAGACCGTTCGGATCACAGGGACAGAGTCTCTCAAGTCGCTCCAGAAAGCTTTGGAAGAGACGGGAAGGG
CGAACAGGCTCATTGGCCAAGGATCGCTTGAAG
GTAAGATTTGAGCAGTTCAAAGAATCAACGGCTAAGTCTAGATTAGGGGTTTTCAATGAGCTGTTGCGATCTTCACGACTCATAGCT
CCTAACCCTTTTGTCATACAAAGTTTGAGTAGAAGCTTGTCAAATGCAAGCATCTAGTGCCATCTACTACTCTCTCGCTTGATGTGGCTTCATGTGCTTCAGGACGATCCGACATGTGGT
TTGACCCGTCACGTTTTTTCCACATGAGTTGCAATGTGATATTCCTTTTTGAGTTCCTCGTTCTCGAGTGATGCTAGCGACTAAGTCCAGGAATCTGCGAATTTCCTTTGAACGTTTCGA
GGCCGAGCCGAGATCATCAGGGCTCTCACCGTCTCTCGCTCATTAAGTGGATGCTTAATTTGAGACCGTCGAATCTATTTGCTTTGAGATCGATCAGAGTCCGAGGGTTTATCCCCCGAA
CCTCTCTTTCCGGTTGAAATCTTGAGGTTGAAATTCGTCCTTTTCGTTATTCGTCCTTTTCGTTTACGTCAGGATTTCGGAGGGTTGAGATCCTCTTCTCCTCACTCAGAGTTGTTGAAA
AGCCTCCAAAATCATCAAAGACTTGTTTTTTCGAGAGGATTTTGTTGACCACGTCCCTCTAAAGCTCGTTGAGCAGACTGTTCAATCTGGCAGCGGAGGACCTCACACTCTCACGTCGCA
AGCTGCTCTCTCGGGTTTATGAAAGACTTTTCGCACCGTCCGGAAACTCTTTGGAACCTCGAGAAGGGTGTTTCGAAGTGGACCGCTCGCAATCAGCTTTCCAAAAAGTTGTTTCGCAGA
GTGCAAGACTTTGGGGCTGTGGCGGAGCCAAGGGCGCTCACCGTCTCTGCTCAATGAATGTCAAAGGGGCCTAGACACCGAGCACAAGACTGTCAATTTGATGCTCATTCAAAAGGACTT
TTTGCGTTCTGATTGTGTTCTGCAGACCCTGCACTGCGGCGTTGATGGGCAGACTCAGCGTCCCTTACTGCTCCTGCTCACAGGTCTGCAGGGAAGATTTGCAGAGCAGTCAGTATGTCG
AGTCCAACCTTTCTGGGACCGGTTCGCAACCCTCTGAGTCTCGATTTGCGAAGTTCAATCGATCGTGGCGGCAGAGTAGGAATCAGCCGACTTCCTCGCGGCTGCTCACGGACTTGCCTG
GTGTCAGCAAAGCCGCACTTACGTCCGGAGAACGATTCTGGAAGCTCTCGTAGTCGCCCAGATTCCGTCGCGAATTCCGTTCTGATCCCGTTTCCGCAAAGTTTGAGATTTCCGCAGCAG
TGGCGGAATCCAAGGGCCCGGTCGTAATGGGCGTCCTCCACATTGCGCAAGTCACCGAGGACACTGCCCGCGTGGAAGGGCAGTTTGACCGGAATCCTGCTGACTTTGTTCTGATTCCGT
TTCGGCAGAGTTTCAGATTTCCGCGGCGGTGGCGGAATCCAAGGGCCCGGTCGTGAGGGGCGTCCTCCGGATCGCGCACGTCACCAAGGACACTGCGCCGGTGGAAGAGCAGTTCGACCG
GATTCCGGCTGAATTTTGCTTTCTTTAAAGTTCCGATTCCGTTTCCGCAGAGTTTGAGATTTCCGCGGCAGTAGCGGAATCCAAGGGCCCGGTTGTGATGGGCGTCCTCCGCATTGCGCA
AGTCACCAGGACACGGCCCCGGTGGAAGGGCAGTTCGACCGGACTGCGGCTGACTTTTATCTCTTTAAATTTTCTGAATCCGTTTTCCGCAGAGTTTGAGATTTCTGCGGCGGTGGCGGA
ATTCAAGGGCCCCGTCGTAATGGGCGTCCTTCGCATCGCGCAAGTCACCAAGGACACTGCCCGGGTAGAGGGCCAGTTCGACGGACTTAAACCGGGCCCGCACGCCGTCTTCCTGAACCA
GTACGGGGACCTGACCCGGGGGGCGGCCAGCACCGGGGGTATTTACATCGACGAG
GTGGGTGCAAGTCCTCGGGTTGGTGTTTAGCCCCTTCGAAGTTGTCTATGGCTTTCGGTCTGTGT
GTTGCTTTAAAAAGGGTTCGACCTTGTGTTGGTTTCATTGGGGGTGAGAACGCCCTGGTGAACAAAGACGGCTCCTTTCATAGCCCGACGCCGGTCGATTCTTGAGTACCCTTTTGAAGT
GCGTGTTGGTTTCATTGGGGGTGAGAAGCTTCTCTTGTGAACAAAGACAGCTCCTTTCATAGGCCGACGCCAGTGCAGTTCTTAAATGCGCCTTGAAGTGTGTTTGTGCTTGGCCAAGCC
AACGATGCCTCACAGGAAATACGCAAGATAGATTATCAAGCCCTGTACCTCGATCCCAAAGGCTCCAGACCTGGTCAGACAAAACCCACTTTTTGTTGCAGGGGCGGGAAGCGGGGTTCC
TGGGAATTGCCAATGCTGACGAAACCGGCCATGCGGAGCTTCCAACGGCGGTGGTCCAACTACGAGTGTACGATCTGATTGGGAGGGCTCTGGTGATCTCAGAAAGTGATAAGGTTTCCA
CGGAAAATGCCTTCGCTTCGGTGGTCGCAAGGAGTGCAGGCGTGGGGCAGAATCTGAAGAATCTGTGCTCGTGCGATGGCACTGTAATCTGGGAGGCCCAGCAGGACAGGGTATCGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTGGGGTCAGAGCAGGAATCCCATCTCGGATGGTCCGGGCTGAGGCGGCAACTGCGGAGGCAAGCGCTGAAGCTGCACCGGAGTTAGTGACTGAATTCATGGTGGACATGATGTGC
GAGGGGTGCGCCACCTCGGTCCGCAACAAGCTGCACCCACTGCCAG
GTGTGACTGACATCAGAACGAGCGTGTCGGATCAGACCGTTCGGATCACAGGGACAGAGTCTCTCAAGTCGCTC
CAGAAAGCTTTGGAAGAGACGGGAAGGGCGAACAGGCTCATTGGCCAAGGATCGCTTGAAG
AGTTTGAGATTTCTGCGGCGGTGGCGGAATTCAAGGGCCCCGTCGTAATGGGCGTCCTT
CGCATCGCGCAAGTCACCAAGGACACTGCCCGGGTAGAGGGCCAGTTCGACGGACTTAAACCGGGCCCGCACGCCGTCTTCCTGAACCAGTACGGGGACCTGACCCGGGGGGCGGCCAGC
ACCGGGGGTATTTACATCGACGAG
GGGCGGGAAGCGGGGTTCCTGGGAATTGCCAATGCTGACGAAACCGGCCATGCGGAGCTTCCAACGGCGGTGGTCCAACTACGAGTGTACGATCTG
ATTGGGAGGGCTCTGGTGATCTCAGAAAGTGATAAGGTTTCCACGGAAAATGCCTTCGCTTCGGTGGTCGCAAGGAGTGCAGGCGTGGGGCAGAATCTGAAGAATCTGTGCTCGTGCGAT
GGCACTGTAATCTGGGAGGCCCAGCAGGACAGGGTATCGTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CAGCCTCAGA GAAGAGACGT TTTCAGCATT GCGGATTCTG CACGTCCCTT CTCTTCCACT GCCAGATTGC CTTTCCTCGC CCTTTGAACG CCCTCAACCA GCTTTGCATC TGTCTTCCGT  TGGTCACCGT CGTTGCGTAA ATTGCTGTCA CCTGCGAAAG CAAGCTCTCT GACCTGCCCA CTCGTGTGAT GGCCTCCGCA CTGCGCTGTT CCACAACTCT TGCAGCAGCC ACCATCGCTG  CAGCATCGGT TCAGACAACA AATACGCATC AAGCTAGAAA TCAGTCTCTA GCCGTCTCTT CTGGTCCGTC CAATCCCTCA GCAGCTGGCC CATTGCTCGG GGGGCTGTCC AAAGACTTTA  CTGAGAGCCA CAGAGGAGCA GCAGGCGCGT CCACATCAGA CAGGTTTATT TCAGTCATGA GTGGGGTCAG AGCAGGAATC CCATCTCGGA TGGTCCGGGC TGAGGCGGCA ACTGCGGAGG  CAAGCGCTGA AGCTGCACCG GAGTTAGTGA CTGAATTCAT GGTGGACATG ATGTGCGAGG GGTGCGCCAC CTCGGTCCGC AACAAGCTGC ACCCACTGCC AGGTGTGACT GACATCAGAA  CGAGCGTGTC GGATCAGACC GTTCGGATCA CAGGGACAGA GTCTCTCAAG TCGCTCCAGA AAGCTTTGGA AGAGACGGGA AGGGCGAACA GGCTCATTGG CCAAGGATCG CTTGAAGAGT  TTGAGATTTC TGCGGCGGTG GCGGAATTCA AGGGCCCCGT CGTAATGGGC GTCCTTCGCA TCGCGCAAGT CACCAAGGAC ACTGCCCGGG TAGAGGGCCA GTTCGACGGA CTTAAACCGG  GCCCGCACGC CGTCTTCCTG AACCAGTACG GGGACCTGAC CCGGGGGGCG GCCAGCACCG GGGGTATTTA CATCGACGAG GGGCGGGAAG CGGGGTTCCT GGGAATTGCC AATGCTGACG  AAACCGGCCA TGCGGAGCTT CCAACGGCGG TGGTCCAACT ACGAGTGTAC GATCTGATTG GGAGGGCTCT GGTGATCTCA GAAAGTGATA AGGTTTCCAC GGAAAATGCC TTCGCTTCGG  TGGTCGCAAG GAGTGCAGGC GTGGGGCAGA ATCTGAAGAA TCTGTGCTCG TGCGATGGCA CTGTAATCTG GGAGGCCCAG CAGGACAGGG TATCGTAGTT GTGGATTAGT GGGAGATTGG  TCATCTAGCA TCTTGTCGTA TAACTTGTTG AAGCCTTTGG CGGACTCGAG CACCCGATGA ACGTTTTTGG ACTCGAGTGG GAGAAACGGA ATCTGATCAA CGAGCCTTCG TGCGGTACAC 
ACTGGTTATA CCAAAGACGT CCAAACGATT CTTTGGACAA TCTCGTTAGG CGCGCGCTCA TTCAGGATGA CTGCATGCTC CCGATTG 

Retrieve as FASTA