Entry information : KflMSD01 (kfl00392_0020)
Entry ID 13861
Creation 2016-08-23 (Christophe Dunand)
Last sequence changes 2016-08-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-10-20 (Christophe Dunand)
Peroxidase information: KflMSD01 (kfl00392_0020)
Name (synonym) KflMSD01 (kfl00392_0020)
Class Mn SOD    [Orthogroup: MSD001]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflMSD01
start..stop
S start..stop
PpaMSD01 292 2e-101 1..224 5..227
CbraMSD03 283 9e-97 18..224 95..303
MpMSD01 280 9e-97 26..221 38..233
LeMSD01 276 4e-95 5..215 2..217
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11531..11704 174 N° 2 10994..11105 112 N° 3 10823..10869 47 N° 4 10554..10679 126
N° 5 10279..10335 57 N° 6 9915..10079 165  
complement(join(9915..10079,10279..10335,10554..10679,10823..10869,10994..11105, 11531..11704))


exon

Literature and cross-references KflMSD01 (kfl00392_0020)
Protein sequence: KflMSD01 (kfl00392_0020)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   226
PWM (Da):   %s   24369.46  
PI (pH):   %s   8.44
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLRHALRSLAPSSRQACAAGAARSVHTVSVPPLDYDYGELEPVISGEIMRLHHQKHHQAYVTGYNTALEKLEGAQAKGDTPAIVALQSAINFNGGGHINHSIFWKNLAPPKGGGEPPSGPLAAALDQEFGSLDAFKSKFAATTAAVQGSGWGWLAYNPDTHHILITTTPNQDPVSARGLVPLLGVDVWEHAYYLQYKNVRPDYLKAIWKVVNWKDVEKRFAAASS*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGCGCCACGCGCTCCGCTCGCTGGCGCCTTCGTCCCGTCAGGCGTGCGCAGCTGGGGCCGCGCGCAGTGTACACACGGTGTCGGTGCCGCCGCTGGACTATGACTATGGCGAGCTG
GAGCCGGTGATCAGCGGGGAGATCATGCGGCTGCACCACCAGAAACACCACCAG
GTACAAGCCCCACCGCAATGCACGCCTCTTAGGGGGCAAGCGATGGCCGCTTGCATGTATGGCATG
CATTGGGGATGCATCGGCCACTGCCCACAGGGGGGACGCTGAGAGCAGTGCTGGGATGGGGGCAAGCAAGGGTAGCAGTACCCAGTAGCTCTACGTGGATCATCTACCCAGCACTCATCT
ATCTTGCCCCCAGCAAACCACCCATCACTCTGCTGAACTCTCGGCTGCGGATGTGGCGATCACCACTTGCAACTTGCAGTTTTTGGAGTTTGGATGCTCTTGACCAGCTCTGGCCGCAGT
GGGGCCAGGCCTGGGGCTAAGGAGTCAGTGCCCATCAGAGGCTGCCACAGTGCATGGTCCACCTCGTCCTGGAGTAGCTCGTTCCCACCACTAACATTCACGCTCCCGCGGGGCTGCAGG
CGTATGTGACGGGGTACAACACGGCGCTGGAGAAGCTGGAGGGGGCGCAGGCCAAGGGGGACACCCCCGCCATCGTGGCCCTCCAGAGTGCCATCAACTTCAACGGCGGAG
GTGAGCATT
AAAGTTTGTGCCGCGCTTGCTGACGCCTGCATCTGCCCCCTGCCCTCCCGCCCATGTGCGCTGCCGCTGGCCTGCCTGCGCGCGCTCCTTCTTCTGACTGGCGCCTGTCCTGCAGGGCAC
ATCAACCACAGCATCTTCTGGAAGAACCTCGCGCCCCCCGCT
GTAAGTCCCCCCGCTGCCCCCTCCAGCGCCCCTGCTCGCTAGCACCTGTGCATGTCACCAAGTTTGCCTCCTGCTGGC
CTCTCTTTCCTCTAGCCCCACGCCTTTCCAAAACCCCGCCCCTGCCTCCGTTGCTGTGTCTGCAGAAGGGCGGTGGGGAGCCCCCGAGTGGCCCTCTGGCTGCGGCGCTGGACCAGGAGT
TTGGCTCGCTGGACGCGTTCAAGTCCAAGTTTGCCGCCACCACCGCCGCGGTGCAAGGCTCCGGCTGGGGG
GTGAGCCGCCCCCACCCCGCCTTGTCCCCGCCCTGCGCCTTGCTCAGCG
TTGCACTTGTGCTGCCTGCCAAATTCTTGAGCTGGCGTTCAGCCCTCCAGCGCCTGTTCTCGTGGAGATTCCCTGAAGATGGCTTGTGCTTCAAGCGGCTCATGTACCGTGTTGCATCAT
CGTATGTCCCGATCTGATTGGTGGCCCTCTGTGTGTTTACTGCGTGCAGTGGCTGGCGTACAACCCCGACACGCACCACATCCTCATCACCACCACACCCAACCAGGTAGGCCACGCCCG
ACCCCGTGTGCACATCAAGGGACGAGCGGTCTAAGCCGGAGGGTTTGCTTGCTGTTGCACAGTTCGAGTCTGTGCTTGGTTGGGAACATGCGTCACGTGAGTATGCTAAAAAAGTTCAGA
TGCGAGCTGCTCGTGAGCGCATGACTGTGAAGCTCGGCTTGATTGGCAGCGGGGTGGGGTTGCAGGATCCGGTGAGTGCGCGCGGGCTGGTGCCGCTGCTGGGGGTGGACGTGTGGGAGC
ACGCCTACTACCTGCAGTACAAGAACGTGCGCCCCGACTACCTCAAGGCCATCTGGAAGGTCGTCAACTGGAAGGATGTCGAGAAGCGCTTCGCTGCAGCATCGTCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGCGCCACGCGCTCCGCTCGCTGGCGCCTTCGTCCCGTCAGGCGTGCGCAGCTGGGGCCGCGCGCAGTGTACACACGGTGTCGGTGCCGCCGCTGGACTATGACTATGGCGAGCTG
GAGCCGGTGATCAGCGGGGAGATCATGCGGCTGCACCACCAGAAACACCACCAG
GCGTATGTGACGGGGTACAACACGGCGCTGGAGAAGCTGGAGGGGGCGCAGGCCAAGGGGGACACC
CCCGCCATCGTGGCCCTCCAGAGTGCCATCAACTTCAACGGCGGAG
GGCACATCAACCACAGCATCTTCTGGAAGAACCTCGCGCCCCCCGCTAAGGGCGGTGGGGAGCCCCCGAGTGGC
CCTCTGGCTGCGGCGCTGGACCAGGAGTTTGGCTCGCTGGACGCGTTCAAGTCCAAGTTTGCCGCCACCACCGCCGCGGTGCAAGGCTCCGGCTGGGGG
TGGCTGGCGTACAACCCCGAC
ACGCACCACATCCTCATCACCACCACACCCAACCAG
GATCCGGTGAGTGCGCGCGGGCTGGTGCCGCTGCTGGGGGTGGACGTGTGGGAGCACGCCTACTACCTGCAGTACAAGAACGTG
CGCCCCGACTACCTCAAGGCCATCTGGAAGGTCGTCAACTGGAAGGATGTCGAGAAGCGCTTCGCTGCAGCATCGTCTTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCACAGGCC CTGCCGCTTT TTCGCAACCG TCTGCTGCGC GTTCCTGCGC GCGGATTGAG TTGGAACCTT CAACCCACGG TTCCTGTTGG TCCATCGCAA GAACAGTGTA CTGCCATGGT  GCTACTACCT AGGACTATCA TAGTACTGCC ATGGTCCGAC TGCTACCTAA TCTCCAGACT TTCTCTGATT CTCATTGTCA CATTGCACTT GGCGTCTGTC CCTACACCGA CCCTGACAGC  CGCTCAGGCC AGGCGTGTCT CCGCCCTCTC GCCTTAATCC AATCCGTTGC GCATCGCGTC TTTGTTGCCC GCTACAATGC TGCGCCACGC GCTCCGCTCG CTGGCGCCTT CGTCCCGTCA  GGCGTGCGCA GCTGGGGCCG CGCGCAGTGT ACACACGGTG TCGGTGCCGC CGCTGGACTA TGACTATGGC GAGCTGGAGC CGGTGATCAG CGGGGAGATC ATGCGGCTGC ACCACCAGAA  ACACCACCAG GCGTATGTGA CGGGGTACAA CACGGCGCTG GAGAAGCTGG AGGGGGCGCA GGCCAAGGGG GACACCCCCG CCATCGTGGC CCTCCAGAGT GCCATCAACT TCAACGGCGG  AGGGCACATC AACCACAGCA TCTTCTGGAA GAACCTCGCG CCCCCCGCTA AGGGCGGTGG GGAGCCCCCG AGTGGCCCTC TGGCTGCGGC GCTGGACCAG GAGTTTGGCT CGCTGGACGC  GTTCAAGTCC AAGTTTGCCG CCACCACCGC CGCGGTGCAA GGCTCCGGCT GGGGGTGGCT GGCGTACAAC CCCGACACGC ACCACATCCT CATCACCACC ACACCCAACC AGGATCCGGT  GAGTGCGCGC GGGCTGGTGC CGCTGCTGGG GGTGGACGTG TGGGAGCACG CCTACTACCT GCAGTACAAG AACGTGCGCC CCGACTACCT CAAGGCCATC TGGAAGGTCG TCAACTGGAA  GGATGTCGAG AAGCGCTTCG CTGCAGCATC GTCTTAAGTC CTAAGGCATA TAGAACGTTT CACCTTGTTT TGGAAGAGTC GCAGAAGTAG CCTTTTACTT CCGGCCAATC CGATCATGTA  TATACAACTC CGTCGCAGAA ATTTGCTAGT CAGATTCAGA AAAGGTTCGC GCCGAGTTTG TTTGAACAAC CAATGCAAGG AGTCTTTCAT CGAGCTTGCA CGTCCTACCC TTTGTGAAAA  TGCCTGAAAC TGCGACAAAC ACTTCTGGTG AGCTGCTGGA CTCACGCTTC AATATAGCTA TCCGGCTGAT CATCGATACC AGGGTACCGT TACTTTGAAG GGGAAGCGGG GTAGGTATTC 
TGATTGGAGA GGGG 

Retrieve as FASTA