Entry information : KflGR02 (kfl00012_0050)
Entry ID 13872
Creation 2016-08-25 (Christophe Dunand)
Last sequence changes 2016-08-25 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-08-25 (Christophe Dunand)
Peroxidase information: KflGR02 (kfl00012_0050)
Name (synonym) KflGR02 (kfl00012_0050)
Class Glutathione Reductase    [Orthogroup: GR001]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflGR02
start..stop
S start..stop
MpGR01 668 0 74..564 60..547
PpaGR01 654 0 87..580 63..555
ThasGR02 641 0 54..579 51..562
HaGR02 634 0 89..579 74..565
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 29603..30045 443 N° 2 30686..30914 229 N° 3 31405..31683 279 N° 4 32223..32619 397
N° 5 33041..33258 218 N° 6 33579..33755 177  
join(29603..30045,30686..30914,31405..31683,32223..32619,33041..33258,33579..337 55)


exon

Literature and cross-references KflGR02 (kfl00012_0050)
Protein sequence: KflGR02 (kfl00012_0050)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   581
PWM (Da):   %s   62494.9  
PI (pH):   %s   6.31
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEAVCSTPCVGQLHFALSRPLTKSPTFGPSVLILRNPCQLAARQQSWGASPKAALSSAHSSFSSPLPVPFQFVAPARKTRSAKLPALPAVRASTEDGQQFDYDLFTIGAGSGGVRASRFASQYGAKVAVCELPFSTKASDDKGGVGGTCVLRGCVPKKLLVYGSHFADYFEDSRGFGWSFPGGEPEVDWSHLIEKKNKELDRLNNAYKTTLKNAKVDLIEGKGIVDRHTVDVDGKRFKVKNILIATGGRIFVPPIPGAEHVITSDDALDLTSVPSKIAIVGGGYIALEFAGIFNSAGAEVDIFVRGDKLLRGFDDEVREFLAEQLQAQGIRIHFGAKPVEIEKRDEDQLTLKTEQGDTWQGSHVMFATGRRPNIKGLGLEEAGVDVDDKTAIKVDEYSRTSVDNIWAVGDVTDRINLTPVALMEGMAFAKTAFQDEPTKPDHTNVPSAVFTNPPIGTVGLTEAEAVEQYGDVDVFTSTFRPMKSTISGNPVRTFVKILVDAATDKVIGLHMCGEDGPEIMGFAVAVRMGVTKKQMDSTVGIHPTSAEELVTMRTPTRQIRKEEAQNGKGEKEMAAAAT*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGCCGTCTGCAGCACCCCCTGTGTGGGGCAGCTGCATTTCGCCCTCAGTCGACCACTGACCAAGTCCCCGACCTTCGGCCCATCCGTCCTGATCCTCCGAAACCCCTGCCAGCTG
GCGGCTCGCCAGCAATCCTGGGGCGCCTCCCCCAAGGCCGCTCTCTCCAGCGCCCACTCTAGTTTCTCCTCTCCCCTTCCCGTGCCATTCCAGTTTGTTGCTCCCGCCCGCAAGACGCGG
TCCGCAAAACTGCCCGCGTTGCCGGCGGTGCGCGCATCAACTGAGGATGGGCAGCAGTTTGATTATGATCTTTTTACGATCGGGGCGGGCAGCGGGGGCGTGCGCGCGTCCCGGTTTGCA
TCGCAGTATGGGGCCAAGGTGGCAGTGTGCGAACTGCCCTTTTCCACCAAGGCCAGCGACGACAAGGGCGGCGTGGGGGGAAC
GTGAGTCACTCAGAATTATGCCCTCCATGTGCATACC
TTTTGCCAGCACGTCTTCTTCTTGTGCAATGCATCTGTCGTTGTTGCATCAAGACCTTCAACTTCCAATGAAAGGGCTCGGTGGCCCGCCAAATGTGATCTGCCTTGGCTGCTTGGGGTC
CTAAGACCAAAAGCTGTGCTGGCTTCAAATGGTTCGATTTTCTCCAGCTCTTTGCGTCAAAACTTGCCACCGGAGCTCCGGCTCGAAAGTTACGATTCTCGATTTTAAACTCCGACTTTG
ATTCCTGATTCCTGATTTTCGAATCTTGTACCCCCCTAGAATGTTATTCTCGAGGAGGTGATTAACCGGGAGCTTGGGAAGACTTCCCTGGTGCGACCAGAAGTTAAGTGATCGGCAGCT
ATCGCCAACAGGAATTACCGGCCAACAAGTATTCAGTTTCTTTCCAGGGGGCAACCGCTGTCCAACCGAACTCGAGATTTACGATCGAAAACTATGAGGAAAACGTCAGGGCTCCGGTGG
CAGGTTTGACGCAAACAGCTGGAAATGTTTTTGACGTCGAGTAAGCTATGTTTTTGCATAGTCTTGGGAGAAGGCCTCTCCAAATTTCCGCTTGTCCCCTGATGGCCTCGCTGTTGTGCG
CAGGTGCGTTCTGCGTGGGTGTGTCCCTAAGAAGTTGCTCGTTTACGGGTCCCATTTTGCGGACTACTTTGAGGACTCGCGCGGCTTCGGGTGGTCGTTCCCGGGGGGTGAGCCCGAGGT
GGACTGGTCGCACCTGATTGAGAAGAAGAACAAGGAGCTGGACCGCCTGAACAACGCGTACAAGACTACGCTCAAGAATGCCAAGGTGGATCTCATTGAGGGCAAGGGCACG
GTGAGTGT
GTCATGACTCCCAGGGATAAATGCTTGAAGAAAAGATGAAGAGAGGATGAAAGGTGGTCAGCATTAGCAACTGGGTAGCCCCTGAAGGTCGTCAGTCTTAGCGACCAGACAAAGGAGAAA
TAAGGGATGTCCTGCAATGAGAACTGATCCCTCTGCCCTTGTATAAACCCTCAAGACAACGAAGACCGCTAGAGAAATACATCAGGGCGCCCGCAGACATTTTTCGCCTGTCCAACAACG
ACTTTAGAAGATTGAATAGACATATACAAGCGGCAGAAATACAGAGAATTTGAATTGTCGAAATGAGTCGAGACGCTAGCGGACGATGATGCCTTTGCCCTTGACTTTTGTTTTGGGCTC
TCAGCTTTCGCCTGATGTCTGCCTGCTGCCGTCGCTTCCAGCTAATTCAAAACCTCCTTGAAGTGACTGTCGACATCGATTCGCAAGACCTCAACATCGCGTCAGCTGCCCCCTCCATGC
AGATCGTTGACCGCCATACCGTTGACGTGGACGGCAAGCGCTTCAAGGTCAAGAACATTCTCATCGCCACGGGGGGGCGCATCTTTGTGCCCCCCATTCCGGGGGCGGAGCACGTGATCA
CCAGTGATGACGCATTGGACCTGACTAGCGTCCCGTCCAAGATTGCCATCGTTGGGGGGGGCTACATTGCACTCGAGTTTGCAGGCATCTTCAACAGCGCAGGCGCTGAGGTCGACATCT
TCGTGCGGGGGGACAAGCTCCTGCGCGGCTTTGATGACGAG
GTGCGATTTCCCTGTGTGGTCAGCACTAAGCAGCAAGGTCTGTCTCGGTCTTTCCGGGCCACTCTTGTGGTCATCATGC
AAAATGCTGTTTTTTTTTTGAGTGTCGAGTAGGTTTTAACGGTATTTGGTCTTGCTTCATTTTTTTTCCGATCAGGGAAGGCTGCCACTCGTGAGGATTGTATGCTTTCGTCTCCATTTC
TAGTCGAAGGCTCAATGTAAACCGCTTTCGGGCTGGATCACAAAATGCAGCCAAAGGCGCTCCTCCTCTGCTCTTTATGGGCTAACCAAGATACTCCCTCTCTTCGTGCACCCTCTTGCC
CGAAAGAGTTTGCAAAAGGGTTGCAAGCATCGAGACCTCATTGTCTCTCACCGCTGAGATCAAAGTTCCTTCAAAGTTTTCAATTCACAAATCCTAGATTTCCAGCCGATAAGTTATTTG
GCAGCTTGACTCGCTTCCAAGCTTCTTTGTTCCTTACCGCTGTGTCTTGCCGCCAGAGTTCAAACCACCCCAAATAACCCGTCAGCTTCCCCCCCGGCAGGTGCGCGAGTTTCTGGCGGA
GCAGCTGCAGGCGCAGGGCATCCGCATCCACTTCGGGGCCAAGCCCGTGGAAATCGAGAAGCGCGACGAGGACCAGCTGACGCTCAAGACGGAGCAGGGTGACACGTGGCAGGGCAGCCA
CGTCATGTTCGCCACGGGGCGGCGGCCCAACATCAAGGGGCTGGGTCTGGAGGAAGCCGGGGTGGACGTGGACGATAAGACGGCGATCAAAGTGGACGAATACTCGCGCACGAGCGTGGA
CAACATCTGGGCGGTGGGTGACGTCACGGACCGCATCAACCTGACGCCGGTGGCGCTCATGGAGGGCATGGCGTTCGCCAAGACGGCCTTCCAGGACGAGCCCACCAAGCCGGACCACAC
CAACGTGCCGTCCGCAG
GTGGGGCAAAGGTTTTGTGATGGTTTTACACTTTCCCGCCAATGGGTTTTGACAGGGTATTGAGTGTGCTTCACGGCTTCGAGTGCAACTTTGGGAACTAATG
ATAGGTGCATGAGACGCAAGAAGGAGATCGAGGCTCAGGCGACCGTTTTGGAGTGCTGAAGTCACGATTACCCGAGGCTGTCAGCTGAAGGGTTAACATATGTACCGCACCGAGGTTGCC
AGATGAGATATCACCATGTTTGCCTTCATTGCGTCACGATTTAGCATTTAAATCTGGACATGGGACTCTGTCGAGCGACGCGAAACGAAGCTCTGCTGACGTGGCACCTCGTCATAGGCT
TCATCGTTTGTTGCCAGCTTGCGGACGTACCTAAGCGCTTCCGCCCAAGTCAACGTTCTGGGGGAGTGTTCTTCGCAGTTTTCACGAACCCCCCCATCGGCACGGTGGGCCTGACGGAGG
CGGAGGCGGTGGAGCAGTATGGTGACGTGGACGTTTTCACGAGCACCTTCCGGCCCATGAAGTCGACCATTTCCGGCAACCCGGTGCGGACCTTTGTCAAGATCCTAGTGGACGCCGCTA
CCGATAAGGTCATTGGGCTGCACATGTGCGGCGAGGACGGGCCAGAGATCATGCAG
GTCAGTGCCCCAAACCCGGCCCGAGGTTTTGAAATCCTAGGGTTTGATTTTTTGGGGTGGAAGG
GTCTGCCCCCCATCTTGTAAGGGGGGGCGATGTGTGACTAGAGAAACGTCGAAGGGAGACGGCTCGTATCTGGTTTCGCCCTCTGTGAAGAGTAGCTTTGCTTTATTCTATTGCAAAAGA
CGAGATTTGAAGCTACGCACCCTGACGTGATCCATCTGGCAAGTGTTCCGTTTTACGTACAATGATTTGTGGTGTTGCTGGCCCCCGTTGCAAGCCGAAACAGAAACATGCTCACCCCGC
TTGAATTCGTGTGCAGGGCTTCGCTGTCGCTGTGCGGATGGGCGTGACCAAGAAGCAGATGGATTCCACGGTGGGGATCCACCCGACGTCAGCCGAGGAGCTTGTGACTATGCGGACACC
GACGAGGCAGATCAGGAAAGAGGAGGCGCAGAATGGGAAAGGAGAAAAGGAGATGGCTGCAGCTGCGACATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGCCGTCTGCAGCACCCCCTGTGTGGGGCAGCTGCATTTCGCCCTCAGTCGACCACTGACCAAGTCCCCGACCTTCGGCCCATCCGTCCTGATCCTCCGAAACCCCTGCCAGCTG
GCGGCTCGCCAGCAATCCTGGGGCGCCTCCCCCAAGGCCGCTCTCTCCAGCGCCCACTCTAGTTTCTCCTCTCCCCTTCCCGTGCCATTCCAGTTTGTTGCTCCCGCCCGCAAGACGCGG
TCCGCAAAACTGCCCGCGTTGCCGGCGGTGCGCGCATCAACTGAGGATGGGCAGCAGTTTGATTATGATCTTTTTACGATCGGGGCGGGCAGCGGGGGCGTGCGCGCGTCCCGGTTTGCA
TCGCAGTATGGGGCCAAGGTGGCAGTGTGCGAACTGCCCTTTTCCACCAAGGCCAGCGACGACAAGGGCGGCGTGGGGGGAAC
GTGCGTTCTGCGTGGGTGTGTCCCTAAGAAGTTGCTC
GTTTACGGGTCCCATTTTGCGGACTACTTTGAGGACTCGCGCGGCTTCGGGTGGTCGTTCCCGGGGGGTGAGCCCGAGGTGGACTGGTCGCACCTGATTGAGAAGAAGAACAAGGAGCTG
GACCGCCTGAACAACGCGTACAAGACTACGCTCAAGAATGCCAAGGTGGATCTCATTGAGGGCAAGGGCACG
ATCGTTGACCGCCATACCGTTGACGTGGACGGCAAGCGCTTCAAGGTC
AAGAACATTCTCATCGCCACGGGGGGGCGCATCTTTGTGCCCCCCATTCCGGGGGCGGAGCACGTGATCACCAGTGATGACGCATTGGACCTGACTAGCGTCCCGTCCAAGATTGCCATC
GTTGGGGGGGGCTACATTGCACTCGAGTTTGCAGGCATCTTCAACAGCGCAGGCGCTGAGGTCGACATCTTCGTGCGGGGGGACAAGCTCCTGCGCGGCTTTGATGACGAG
GTGCGCGAG
TTTCTGGCGGAGCAGCTGCAGGCGCAGGGCATCCGCATCCACTTCGGGGCCAAGCCCGTGGAAATCGAGAAGCGCGACGAGGACCAGCTGACGCTCAAGACGGAGCAGGGTGACACGTGG
CAGGGCAGCCACGTCATGTTCGCCACGGGGCGGCGGCCCAACATCAAGGGGCTGGGTCTGGAGGAAGCCGGGGTGGACGTGGACGATAAGACGGCGATCAAAGTGGACGAATACTCGCGC
ACGAGCGTGGACAACATCTGGGCGGTGGGTGACGTCACGGACCGCATCAACCTGACGCCGGTGGCGCTCATGGAGGGCATGGCGTTCGCCAAGACGGCCTTCCAGGACGAGCCCACCAAG
CCGGACCACACCAACGTGCCGTCCGCAG
TTTTCACGAACCCCCCCATCGGCACGGTGGGCCTGACGGAGGCGGAGGCGGTGGAGCAGTATGGTGACGTGGACGTTTTCACGAGCACCTTC
CGGCCCATGAAGTCGACCATTTCCGGCAACCCGGTGCGGACCTTTGTCAAGATCCTAGTGGACGCCGCTACCGATAAGGTCATTGGGCTGCACATGTGCGGCGAGGACGGGCCAGAGATC
ATGCAG
GGCTTCGCTGTCGCTGTGCGGATGGGCGTGACCAAGAAGCAGATGGATTCCACGGTGGGGATCCACCCGACGTCAGCCGAGGAGCTTGTGACTATGCGGACACCGACGAGGCAG
ATCAGGAAAGAGGAGGCGCAGAATGGGAAAGGAGAAAAGGAGATGGCTGCAGCTGCGACATAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACTGCAGCTT CACAGACTGA GCTCAAGTTG CGACCATCGT GAAGGGCCCG GGTCCGTTGC AACTTGCAAC GCATTACATT GAATTTGTGC TTTGTGTGGT TCATCAGAAG GACAGTGGTG  GTTCAGGTAC GCGGCCGGAG GAAGCAAACT ACCTAAGGGT TTCTGAGGAA GTTGCCAAGC CTTCCAAGCG TCTTCGCGTG CGCTGCACTC TCAACATCAA AATGGAGGCC GTCTGCAGCA  CCCCCTGTGT GGGGCAGCTG CATTTCGCCC TCAGTCGACC ACTGACCAAG TCCCCGACCT TCGGCCCATC CGTCCTGATC CTCCGAAACC CCTGCCAGCT GGCGGCTCGC CAGCAATCCT  GGGGCGCCTC CCCCAAGGCC GCTCTCTCCA GCGCCCACTC TAGTTTCTCC TCTCCCCTTC CCGTGCCATT CCAGTTTGTT GCTCCCGCCC GCAAGACGCG GTCCGCAAAA CTGCCCGCGT  TGCCGGCGGT GCGCGCATCA ACTGAGGATG GGCAGCAGTT TGATTATGAT CTTTTTACGA TCGGGGCGGG CAGCGGGGGC GTGCGCGCGT CCCGGTTTGC ATCGCAGTAT GGGGCCAAGG  TGGCAGTGTG CGAACTGCCC TTTTCCACCA AGGCCAGCGA CGACAAGGGC GGCGTGGGGG GAACGTGCGT TCTGCGTGGG TGTGTCCCTA AGAAGTTGCT CGTTTACGGG TCCCATTTTG  CGGACTACTT TGAGGACTCG CGCGGCTTCG GGTGGTCGTT CCCGGGGGGT GAGCCCGAGG TGGACTGGTC GCACCTGATT GAGAAGAAGA ACAAGGAGCT GGACCGCCTG AACAACGCGT  ACAAGACTAC GCTCAAGAAT GCCAAGGTGG ATCTCATTGA GGGCAAGGGC ACGATCGTTG ACCGCCATAC CGTTGACGTG GACGGCAAGC GCTTCAAGGT CAAGAACATT CTCATCGCCA  CGGGGGGGCG CATCTTTGTG CCCCCCATTC CGGGGGCGGA GCACGTGATC ACCAGTGATG ACGCATTGGA CCTGACTAGC GTCCCGTCCA AGATTGCCAT CGTTGGGGGG GGCTACATTG  CACTCGAGTT TGCAGGCATC TTCAACAGCG CAGGCGCTGA GGTCGACATC TTCGTGCGGG GGGACAAGCT CCTGCGCGGC TTTGATGACG AGGTGCGCGA GTTTCTGGCG GAGCAGCTGC  AGGCGCAGGG CATCCGCATC CACTTCGGGG CCAAGCCCGT GGAAATCGAG AAGCGCGACG AGGACCAGCT GACGCTCAAG ACGGAGCAGG GTGACACGTG GCAGGGCAGC CACGTCATGT  TCGCCACGGG GCGGCGGCCC AACATCAAGG GGCTGGGTCT GGAGGAAGCC GGGGTGGACG TGGACGATAA GACGGCGATC AAAGTGGACG AATACTCGCG CACGAGCGTG GACAACATCT  GGGCGGTGGG TGACGTCACG GACCGCATCA ACCTGACGCC GGTGGCGCTC ATGGAGGGCA TGGCGTTCGC CAAGACGGCC TTCCAGGACG AGCCCACCAA GCCGGACCAC ACCAACGTGC  CGTCCGCAGT TTTCACGAAC CCCCCCATCG GCACGGTGGG CCTGACGGAG GCGGAGGCGG TGGAGCAGTA TGGTGACGTG GACGTTTTCA CGAGCACCTT CCGGCCCATG AAGTCGACCA  TTTCCGGCAA CCCGGTGCGG ACCTTTGTCA AGATCCTAGT GGACGCCGCT ACCGATAAGG TCATTGGGCT GCACATGTGC GGCGAGGACG GGCCAGAGAT CATGCAGGGC TTCGCTGTCG  CTGTGCGGAT GGGCGTGACC AAGAAGCAGA TGGATTCCAC GGTGGGGATC CACCCGACGT CAGCCGAGGA GCTTGTGACT ATGCGGACAC CGACGAGGCA GATCAGGAAA GAGGAGGCGC  AGAATGGGAA AGGAGAAAAG GAGATGGCTG CAGCTGCGAC ATAGGCGAGG GGACTCCCTT CCGGTTATAA GGAAATTAAC ATCGACTTAT ATGCAGGCGC CTGTAGATGT CCAAAAGGAG  TTCTCGTGTT GAGGTTATGC CGTTTTCGAG TGTTGTGCAT ACGACTTGAA CTAATTTCGG TTTGAATATG TGGATAGATT TGTGACGGAG TCACCTTCTT GCTAGCGCCT GATCAATGAG  AAAACTTATG ATCCAGCTGT GTCGATACAT AGCCGGTAAG GGGGTTGGAG CTGCAACTTT GCTTCTGCGA CTTTGCTTCG ACAATTTTCA AACCATTGAT GGTTGTTTGA CAATCTCCTG 
TTGATGATAG CGCTCTGATC CCTTAACCTG AATGTAAACA TTGTCGGCGA TTGCGAACGT GTATAATAAG CTTCCAG 

Retrieve as FASTA