Entry information : KflMDAR03 (kfl00287_0080)
Entry ID 13875
Creation 2016-08-25 (Christophe Dunand)
Last sequence changes 2016-08-25 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-08-25 (Christophe Dunand)
Peroxidase information: KflMDAR03 (kfl00287_0080)
Name (synonym) KflMDAR03 (kfl00287_0080)
Class Monodhydroascorbate Reductase    [Orthogroup: MDAR002]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflMDAR03
start..stop
S start..stop
MpMDAR02 580 0 1..476 1..485
HaMDAR02 577 0 1..468 1..473
PpaMDAR04 570 0 1..476 1..486
HaMDAR04 562 0 1..468 1..473
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 41617..41736 120 N° 2 41949..42000 52 N° 3 42195..42275 81 N° 4 42452..42570 119
N° 5 42998..43217 220 N° 6 43675..43793 119 N° 7 45018..45248 231 N° 8 45748..46236 489
join(41617..41736,41949..42000,42195..42275,42452..42570,42998..43217,43675..437 93,45018..45248,45748..46236)


exon

Literature and cross-references KflMDAR03 (kfl00287_0080)
Protein sequence: KflMDAR03 (kfl00287_0080)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   476
PWM (Da):   %s   51661.87 Transmb domain:   %s   o446-468i
PI (pH):   %s   9.34
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGRAFKFVVLGGGNAAGYAAHEFIKRGIGPGELCIISEEPVAPYERPALSKGYLLPEGAVRLPAFHTCVAIGHERQVRAWYQDHGIELLLNTRVTSADVKKRALTTQSGETITYKTMIVATGAVLRLEEFGVTGADASNICYLRDIRDAAFLVDAMRPGQGMKAVVIGGGYIGMECTAALVANKLDVTMVYPEPHCMARLFTPEIAQFYEDRYRKKGVKFVKGTVMAAFEKSSSGKVAAVILKDGTRLPADLVVVGVGIRANTALFEGQLAIEKGGIKVDSKFRTSVSTVYAVGDVAAFPVKLYGDIRRLEHDHARKSARHAVSAILSGDTTKDYDYLPFFYSRVFNLSWQFYGDNVGKCVLFGDQSRGKFGAYWIDERNAVVGTFLEGGSSEDYTAMARVARVRPEAPPDLADLGLSFATKLPAGELSQSSAAGKVLSIIEDPYTWQIGTSLALVVGVAAVAYWHHRRRKKLL*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGAGGGCTTTCAAGTTTGTGGTACTAGGAGGTGGCAATGCAGCAGGATATGCTGCTCATGAGTTTATTAAGCGAGGGATTGGGCCGGGAGAGCTGTGCATCATCTCTGAAGAACCG
GTGAGCACCTTATGAAACCTTATAAGCACTTCAAGTTGATCTTACAGCATATAAATTTCACTCTTCCTCCCAAGGAAACAATTGAGCAAGCTGTCAAATTGCCGGGGTTGTTCTCTGGAT
ATTCAATTGCATGGAGCAGGGCAATCGAGGATACAATGATCATCTTTACAGGGGGCTATGTAAGAGTGTTCTTAGCTCTTTCTTCTTTGCAGGTGGCACCATATGAGCGCCCCGCCCTCA
GCAAAGGCTATCTGCTTCCCGAAG
GTAACACGGTCTGCTTGTGATTGGTGGACCAAGTCTCCTTGCCTCCTGGCTTTTGACAGAGACACAATTCTCTCCCCCTCTAGAAGAAAGCACACC
TTTGTTGGGCCTTCGTAGCAATCTCCGTTTGAACTTCCTTGTGCAAGCCTCTTCTAAGAACTACCCGCAATCTTACCTCTGACCTTCTTCGTTTCTAGGCGCTGTCCGTCTTCCAGCCTT
CCACACCTGCGTCGCAATAGGTCATGAGCGCCAAGTCCGGGCCTGGTACCAAGACCATG
GTAAGAAGTTCTTCGTGGTACATTGACCTATGTTATGCCACAATAACATAACATGCACACT
TATGTACTCCTCCTAGGTCTGACAAGGTATCAGCAACTACAGTTACTCTGTCTTTTTAGAAGCAGATTGTCGTGGCTCAGGTTGAACCAGCTTCTCGGTTGCCCTGTCTGTCCAGGGATT
GAGCTGCTCTTGAACACGCGGGTGACCAGTGCGGACGTTAAGAAGCGCGCCTTGACGACACAGTCTGGGGAGACGATAACGTACAAGACAATGATCGTCGCAACTGGTGCAAGG
GTAAGG
CTGATGTAATCAGACCTAAAAGCTCACGCTTCTTCTGTCATGATTTCAAATTAAAATCAATACAAAACTTCTCCAAGGCCGGAAAAATCGTAGGCAGACTTCCTCTAGACATGCCACTGG
TAGACTCCAGAGTCTCCAGATGGCCAAAACTTCGTTGCAGCTGAGTCAGATATCGAGCACGGACTTCTTGCGAGGGTCGAGGGAGGAAGTCATACGGGGTTGATCTAGGAGTTATTAAAG
ACCTAGAAGAATTGGATCAAGCAAGTCCGCCTGATGTATCCTTCTTGCAATCTTGTTCAAGTGCTTCCTTCTTATGCATCCACAACAACATGAGAGAACGGGAAGCAGCGACGCCGTCTC
GAGCCGTCCTCAGATCAGTCTGCCTGGGCTATCTGAGCGGTCACTCTGAGTGCTCATCCAGGTCTTGCGCTTGGAAGAGTTTGGCGTGACCGGCGCCGATGCGTCGAACATCTGTTACCT
GCGAGACATCCGCGATGCCGCCTTCCTAGTGGATGCCATGCGCCCGGGTCAGGGCATGAAGGCTGTCGTCATCGGCGGGGGCTACATTGGCATGGAGTGCACGGCTGCGCTGGTGGCTAA
TAAGCTGGACGTCACCATGGTGTACCCAGAGCCGCACTGCA
GTGAGTTGCGCCAACTGGAGTCAGAGCCGTTTCCATTCAGTGCAATCCCTGGAACTGTACGAAGTTCACCTGAGGAGAT
GCATCGGTTGGGGATGGTAGAACTAGCGAAAAGTGGGGGGGGCCTGAATCCTACGACCAGTTGAGCCTGGCCTTACTGGACGAAACGAACGCAGTTTTAGATACGGAACGACTAATAAGC
ACACGGTGGTTGTCTGGATCTCGACTTGCACAGGAGGTTGTACGTTAGCTTGGGAAGTGAGCGTCCGGATTCCGTTCACCGCACCAAAGTCTGCTCCAGTGCGTTTCGTTTTGCAGAGTG
TAGCAGTCTCAGAAGCTTTACTCTCATATGCTTGCAGCATGTAGCGTGTCTGCAATTATTACAATTTAAACAGCCACAGAAATGCAAGCGGCATAGGAACTTCAGCGAAAATTCTGAGCC
CTGATTTCTTTCCTGCAGTGGCCCGACTCTTCACTCCCGAGATTGCTCAGTTCTATGAGGACCGGTACCGGAAGAAGGGGGTCAAGTTTGTAAAAGGAACGGTCATGGCCGCCTTTGAGA
AGAGTTCGTCGGGAAAG
GTGAGGGTCAGCCATTCGCAAGCTGTTTCGCGCTTGTCGATGGCACAGCTCTCATGCAACGGCTGTTCATGTTGGTTGTTGTCGTAAAAGTCATTGTTTCATC
CTTGCATGATTTTTATTGCTGACCGAACCCGTTGAAACATAGCGCAAAAGCTAGAGAGGACCTCCCAACATCATAACACCCTTTCAGCTGAGCACCTCAGACCTCTGAAGTTTTCACTAC
CTTGGCGGTTGTTATATGCTGTTTTTCTGAGTGTTGCGATGAGCTTTTCACCCAACTGCACAAAACCAACCTTTGCTTTGTTCAAAGCGGTTCATTACGTCTTTGCCGAATAGGGCGCCA
CGAAACACAACGCGGATGGTACTGACAGCAGGAGAGTACGTGTTCGATAGTTAAGCCTATCAATCCCTGATTAAGCTTCGCCTCTTTGCTTGTCTTCCCTCGCTGCTACTCCAAGGTATG
CCGTCACAGCGGAATCTAATTGGCCGTAAGTCAGCTGGTAACCGTCTGCTTTGCGGGACTTCTGAAAAACGTGCCCCGCTTGCTGGCGTATTTTGACTGTGAATGTTCTTGATCTTTGAC
TATTCTCTTCGGCCCTCCGCTTCCCCTCGGTGCGCTTCCAATCATGCCATCTAATCGAATTCAATGTTCTAAGAAGTCAACCGGCTGCCGGCCGCTACAGATACCCGCAGTAATTCCAAA
AGACAAAATTCGCTTGCCAACATGATTGACATTAAGCGTTCTCGACTCTGACCATCAAGTTCGGCTGTTTGCTTGCCTTCCGTCGCTGCGGTCCTAATTATGCCGTCAAAAAGGATTCCA
ATCTCTGAATCAACTGGGTACCGTTCGCTACAGGTAGCCGCGGTAATCTCGAAAGACGGGACGCGCGTTTGGGCGGACTTGGTGGTTCAAAGTCCCCAATCTCTGACCATCGTCCGGTCA
TTGCTTATTGTCGCGACTCCGGAATTACTGTCGGAACGCAAATCACGTTTCTGAAATCAGTCAAAACAGTTTATGTAACAAAAGGGCTACCGTCCGCTACAGGTAGCCGCTGTGATCCTG
AAAGACGGGACGCGCCTCCCGGCGGACCTTGTAGTTGAAGTTTCAACCTCTGACAATCGTTTGAATATTTGCCTGTCTTCTCGACTCCGAGATTGCTGTCCAAGCGGAATCCACTTTTCT
TAGATTAACAAAACCAATGAAAAGGCTCCCGTCCGCTACAGGTAGCCGCGGTGATCCTAAAAGACGGGACGCGCCTCCCGGCGGACCTGGTGGTGGTCGGGGTGGGCATCCGGGCCAACA
CGGCGCTCTTCGAGGGCCAGCTGGCGATCGAAAAAGGCGGCATTAAGGTGGACTCCAAGTTCCGGACGAGCGTCAGCACCGTGTATGCCGTCGGGGACGTGGCGGCCTTTCCCGTGAAGC
TTTATGGGGACATCCGCAGGCTGGAGCACGTG
GTAAGGCTGACGTGGCATGCTTGGGAGAGTGGATTTGAATGGCCTCGGTTCTTGTGGTGGGGTTTCGACATTGTTACGGAATCATAGA
GCGCTCGTTTCTTCGTGCTGGTGCGTTCGAAGAGGCTTTCAGGATTCATTTCCTTCTCGGTTCCGGACCCTGGTTCTAGTAAATACTGGTCGGTCTCCATCCAGTGCCATTGTGGTGCAA
GCGACGAGAGACTATGGCAAGACGTCAGAATCGAGCTGTCAAGTTGACAAAACGGGGGACCTTTTATCTTGCTGCAGTGACAGCACGTCCGCATGGCGCTCGCTTGCGGGGTTTCCCTCC
CAAATATCATCGTCGTAAAGATCAGGAGATTCAAAAAATCCGAAACTGTTGTATTCACGTCCACCTGTACCATTCTCGCCAAGATCTTCCCGTTCCGAGGCTTTGATAACACCTTGCAGC
CCGTTTGATTTACCTATGTTGATACTTCCTGCTTTGCCCCGCCGTATGCAGGACCACGCGCGCAAGTCTGCCCGCCACGCCGTGTCCGCCATCCTCTCGGGCGACACCACCAAGGACTAC
GACTACCTGCCCTTCTTCTACTCCCGGGTCTTCAACCTCTCCTGGCAGTTTTACGGGGACAACGTCGGGAAGTGCGTCCTTTTCGGGGACCAGTCAAGAGGGAAGTTCGGCGCGTACTGG
ATCGACGAACGGAACGCCGTGGTCGGCACGTTTTTGGAAGGGGGCAGCAGTGAAGATTACACGGCGATGGCGCGGGTCGCGCGGGTCCGCCCGGAGGCTCCCCCCGACCTGGCTGATCTC
GGGTTGAGTTTCGCGACCAAGCTGCCGGCAGGGGAGCTCTCGCAGAGTTCGGCGGCCGGGAAGGTGCTGAGCATCATCGAAGACCCGTACACGTGGCAGATTGGGACGTCACTGGCGCTG
GTTGTTGGGGTCGCAGCAGTAGCGTACTGGCACCATCGGCGAAGGAAGAAGCTATTGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGAGGGCTTTCAAGTTTGTGGTACTAGGAGGTGGCAATGCAGCAGGATATGCTGCTCATGAGTTTATTAAGCGAGGGATTGGGCCGGGAGAGCTGTGCATCATCTCTGAAGAACCG
GTGGCACCATATGAGCGCCCCGCCCTCAGCAAAGGCTATCTGCTTCCCGAAGGCGCTGTCCGTCTTCCAGCCTTCCACACCTGCGTCGCAATAGGTCATGAGCGCCAAGTCCGGGCCTGG
TACCAAGACCATG
GGATTGAGCTGCTCTTGAACACGCGGGTGACCAGTGCGGACGTTAAGAAGCGCGCCTTGACGACACAGTCTGGGGAGACGATAACGTACAAGACAATGATCGTCGCA
ACTGGTGCAAGG
GTCTTGCGCTTGGAAGAGTTTGGCGTGACCGGCGCCGATGCGTCGAACATCTGTTACCTGCGAGACATCCGCGATGCCGCCTTCCTAGTGGATGCCATGCGCCCGGGT
CAGGGCATGAAGGCTGTCGTCATCGGCGGGGGCTACATTGGCATGGAGTGCACGGCTGCGCTGGTGGCTAATAAGCTGGACGTCACCATGGTGTACCCAGAGCCGCACTGCA
TGGCCCGA
CTCTTCACTCCCGAGATTGCTCAGTTCTATGAGGACCGGTACCGGAAGAAGGGGGTCAAGTTTGTAAAAGGAACGGTCATGGCCGCCTTTGAGAAGAGTTCGTCGGGAAAG
GTAGCCGCG
GTGATCCTAAAAGACGGGACGCGCCTCCCGGCGGACCTGGTGGTGGTCGGGGTGGGCATCCGGGCCAACACGGCGCTCTTCGAGGGCCAGCTGGCGATCGAAAAAGGCGGCATTAAGGTG
GACTCCAAGTTCCGGACGAGCGTCAGCACCGTGTATGCCGTCGGGGACGTGGCGGCCTTTCCCGTGAAGCTTTATGGGGACATCCGCAGGCTGGAGCACGTG
GACCACGCGCGCAAGTCT
GCCCGCCACGCCGTGTCCGCCATCCTCTCGGGCGACACCACCAAGGACTACGACTACCTGCCCTTCTTCTACTCCCGGGTCTTCAACCTCTCCTGGCAGTTTTACGGGGACAACGTCGGG
AAGTGCGTCCTTTTCGGGGACCAGTCAAGAGGGAAGTTCGGCGCGTACTGGATCGACGAACGGAACGCCGTGGTCGGCACGTTTTTGGAAGGGGGCAGCAGTGAAGATTACACGGCGATG
GCGCGGGTCGCGCGGGTCCGCCCGGAGGCTCCCCCCGACCTGGCTGATCTCGGGTTGAGTTTCGCGACCAAGCTGCCGGCAGGGGAGCTCTCGCAGAGTTCGGCGGCCGGGAAGGTGCTG
AGCATCATCGAAGACCCGTACACGTGGCAGATTGGGACGTCACTGGCGCTGGTTGTTGGGGTCGCAGCAGTAGCGTACTGGCACCATCGGCGAAGGAAGAAGCTATTGTGA

Retrieve as FASTA