Entry information : CgCSD01 (CgCuZnSOD)
Entry ID 13887
Creation 2016-09-06 (Marcel Zamocky)
Last sequence changes 2016-10-10 (Christophe Dunand)
Sequence status complete
Reviewer Marcel Zamocky
Last annotation changes 2016-10-21 (Marcel Zamocky)
Peroxidase information: CgCSD01 (CgCuZnSOD)
Name (synonym) CgCSD01 (CgCuZnSOD)
Class Cu/Zn SOD    [Orthogroup: CSD001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Chaetomiaceae Chaetomium
Organism Chaetomium globosum    [TaxId: 38033 ]
Cellular localisation Cytosolic
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CgCSD01
start..stop
S start..stop
HaCSD02 177 4e-57 1..152 80..230
HaCSD01 175 7e-57 1..153 45..196
KflCSD02 172 1e-55 1..153 58..208
LeCSD01 164 3e-53 1..152 1..150
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..13 13 N° 2 246..425 180 N° 3 500..651 152 N° 4 711..807 97
N° 5 866..888 23  
join(1..13,246..425,500..651,711..807,866..888)


exon

Literature and cross-references CgCSD01 (CgCuZnSOD)
Literature REFERENCE 1 Cuomo CA et al. (2015) Draft genome sequence of the cellulolytic fungus Chaetomium globosum. Genome Announc. 3:E0002115.
REFERENCE 2 Zamocky M. et al. (2016) Genome sequence of the filamentous soil fungus Chaetomium cochliodes reveals abundance of genes for heme enzymes from all peroxidase and catalase sueprfamilies BMC Genomics 17:763.
Protein ref. Genebank:   XP_001222495.1 UniProtKB:   Q2H4L5
DNA ref. GenBank:   NT_165978.1 (3439244..3440131)
mRNA ref. GenBank:   XM_001222494.1
Cluster/Prediction ref. Genebank:   4390889
Protein sequence: CgCSD01 (CgCuZnSOD)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   154
PWM (Da):   %s   15802.81  
PI (pH):   %s   6.6
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVKAVAVVRGDSKVTGSIIFEQESESSPTTVTWDITGHDANAKRGMHIHTFGDNTNGCTSAGPHFNPHGKTHGAPVDENRHVGDLGNIETDAQGNSKGTVTDKHIKIIGPESVIRTVVVHAGTDDLGKGGNEESLKTGNAGPRPACGVIGISQ

Retrieve as FASTA  
Remarks Complete sequence from genomic (scaffold 3, 4 introns). Strain=CBS 148.51 (CHGG_06400).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCAAGGCTGGTAAGTCCAAAGCTTCTTGCATTACCCCGCCATCCACGGCACCCACCCGGGACTCGGGAGAGCTGCGTCTAGGATGGGAGGGGTTGCGAGCTCAATCAGCTTCAACT
TGCAACCTTGATGGGCACTTTATCATCACATGGACACGCTAGGCATTGGTACCTTGCATGTAAATGCAGAGATGATTGAACACTGGGTCACCAAATGAAACCAATGCTAACCTGCGCATC
TTCAGTCGCTGTCGTCCGTGGTGACTCGAAGGTCACTGGCTCCATCATCTTCGAGCAGGAGTCCGAGTCCTCCCCTACCACTGTCACCTGGGACATCACTGGCCATGACGCCAACGCCAA
GCGTGGCATGCACATCCACACCTTTGGCGACAACACCAACGGCTGCACCTCGGCTGGCCCGCATT
GTATGTTCCCCTAGCAGTCCCTAAGTTGTTGGCTCCTTTGTTTGGACGTGGACTA
ATGCTAAGCCTTTCCACAGTCAACCCCCACGGCAAGACCCACGGCGCCCCGGTTGACGAGAACCGTCATGTTGGTGACCTCGGCAACATCGAGACAGACGCTCAGGGCAACTCGAAGGGC
ACCGTGACCGACAAGCACATCAAGATCATTGGCCCCGAGAGCGTCATTGGC
GTATGTCCTATGTCCCAAACAAAGTGGCATGCGGAGGATCAAGTACTAACATCAACCAGCGCACTGTCG
TTGTCCACGCTGGCACTGACGACCTCGGTAAGGGGGGCAACGAGGAATCCCTCAAGACCGGCAACGCCGGCCCCCGCCCTGCCTGCG
GTAAGATACCAGTTACCTTTGCCTATACTGAAA
ACCGGCTGCTAACTAACGATATCAGGTGTCATTGGCATCTCGCAGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCAAGGCTGTCGCTGTCGTCCGTGGTGACTCGAAGGTCACTGGCTCCATCATCTTCGAGCAGGAGTCCGAGTCCTCCCCTACCACTGTCACCTGGGACATCACTGGCCATGACGCC
AACGCCAAGCGTGGCATGCACATCCACACCTTTGGCGACAACACCAACGGCTGCACCTCGGCTGGCCCGCATT
TCAACCCCCACGGCAAGACCCACGGCGCCCCGGTTGACGAGAACCGT
CATGTTGGTGACCTCGGCAACATCGAGACAGACGCTCAGGGCAACTCGAAGGGCACCGTGACCGACAAGCACATCAAGATCATTGGCCCCGAGAGCGTCATTGGC
CGCACTGTCGTTGTC
CACGCTGGCACTGACGACCTCGGTAAGGGGGGCAACGAGGAATCCCTCAAGACCGGCAACGCCGGCCCCCGCCCTGCCTGCG
GTGTCATTGGCATCTCGCAGTAG

Retrieve as FASTA