Entry information : KflFer02 (Kfl_000930210)
Entry ID 13896
Creation 2016-10-14 (Christophe Dunand)
Last sequence changes 2016-10-14 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-10-14 (Christophe Dunand)
Peroxidase information: KflFer02 (Kfl_000930210)
Name (synonym) KflFer02 (Kfl_000930210)
Class Ferritin    [Orthogroup: Fer002]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflFer02
start..stop
S start..stop
AtrFer01 208 5e-67 87..282 46..238
PpaFer03 207 2e-66 55..289 33..264
AtFer03 205 7e-66 89..287 62..257
SpolFer01 201 5e-64 69..287 38..255
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 113404..113691 288 N° 2 112457..112653 197 N° 3 111498..111708 211 N° 4 110571..110636 66
N° 5 109886..110011 126  
complement(join(109886..110011,110571..110636,111498..111708,112457..112653,1134 04..113691))


exon

Literature and cross-references KflFer02 (Kfl_000930210)
DNA ref. GenBank:   DF237042.1 (113691..109886)
Protein sequence: KflFer02 (Kfl_000930210)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   295 (278)
PWM (Da):   %s   32691.25 (30983.3)  
PI (pH):   %s   4.59 (4.53) Peptide Signal:   %s   cut: 18 range:18-295
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFSLAHAGVLNLQALAFSPASCTTSQNAVRSSTGVAPAFMKQRAPFMFNSRRRCASIVAAADGNSSYRDLETVSAGSTEEISEEVLGGEIFRPMQDLQESGILDLVDQRGNDTSLARQRYSPDTETAINDSINVAYTLSYAFHSMAAFFDRDNIALQNVAKYFYDRSKYELDDALKLTDYQNRRGGRVQLLPLQAPFSEFDDPEKGDALNTFELALGLEKIQNEKYLALQAIAEVGDPQADDYVKSTYLHPQIEKLKRTAEQVRQLRRVGKGYGVWHFDQELEGGEEIPEPVA*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTTTTCACTGGCGCACGCTGGTGTGCTGAACCTACAAGCTTTGGCATTCTCTCCTGCCTCTTGTACCACCTCTCAGAATGCTGTGAGGTCCTCAACAGGAGTTGCGCCAGCTTTC
ATGAAGCAGCGCGCGCCATTCATGTTTAACTCAAGGAGACGTTGCGCTTCGATCGTGGCAGCAGCAGATGGCAACTCCAGCTATCGGGACTTAGAAACCGTGTCGGCTGGAAGTACAGAA
GAAATTAGCGAAGAGGTGCTTGGGGGCGAGATTTTCAGGCCGATGCAG
GTAAGCTGCATCTCTTTGTAGCAAGTATGCCGTACAGTTCTGATCAAGAAGCCGTTTTTTCTAGCGTGATAT
ATCTTCGGCATTGTGCATGCATCAGCTATTTCCATTCTCTTATTGACATTGTACCGCACCTATTGTATGCTTCTTGATTCTCTGTCCATATATGTTTTTTTGGCACTAGGAATGCCAACC
ACAGCAGCTGTTTAGTATTGCCATTTTGAGTTTGGGGGGTGTCAATTGATTCTATGAATTGGCTTTAGTAACAGCTGGCTTGTCATTTCAATGCAGATGATTCTGACAAGCGTGTATAGG
TTGTGTGCATGCAATTGTGAGACATGTTCACCCTTCATCAAAGTTGGGCTTACTGAGGAGCCTTGTTATTTAGAAAGTCATGAGGAATCTGAGCCTTTGCTCATTATGATACATATTCTT
GAAAACCTAGTGGCAATGTTACCAAGTGGTCCACTTTCAGAGGCACCAAACCAGAGAGTGTGGCGGGATAATTGTTGACGGTGACCCCCAAGAGAAAGGTCCTGTGCAGGATGTGGCGCC
TGCGCTGGATGGTCGTTCATGTATGCTGTAAATACGAGCTCATGTGGCCATGGTATTGACTTTTCTCGTTTGAAGAAGCCGTAAAGTTTCGCTTACAACCAGTCATTTGTACTGAGACAG
CTTGCTCCAGAACTACCTGGATATTGTTTCAAACCACCGCAAGGAAGTCAGCGATGAAGCCTGGATACTTTTCTGCAGGATCTTCAAGAGTCTGGCATCCTTGACCTTGTGGACCAACGA
GGCAACGACACATCGCTGGCCAGGCAGCGCTACTCTCCAGACACGGAGACCGCCATCAATGACTCAATCAATGTTGCATATACGCTCAGCTATGCATTCCACAGCATGGCGGCCTTCTTC
GATCGGGACAACATCGCGCTTCAGAACGTCGCCAA
GTGAGTGACTCAAGTCCTCGCCGCTAGTTCGGGAATATTGCGTTAGGTGCCCGCTGGAGAATTGATAAAGACAAGAGCTTTTGAG
ATATTATTCTCCAACCTTTTTCGATAATGATTAGAACGTCTGACTGATTTAGGAAAATGGCAATGCTGTTGTACATCCAACATTCCTTCCAAATTTGAGGGCTCCGACGCTGATTGTCAG
CGTCGCCCTAGCCTTCGAGCATTCTCAAGCGGTACACATTCCGACTATTGACCATGTTCTTGACAGCCAGTTGTGCCCAGAGCGCAAGTGTGCGTCCGAATTATCCACTGAAACTAGAAT
AGTCACCAAATTCAAGAGTGCCCCTACCTTCAAAAAGGACCTTCCTTTACCTCAGCTTCATGTAGTTGAATGAGAAGCCAACTCTGGATGGAGTTCCTCAGTACATATTGAGCTGTATTC
CCTATCAAGAGGAAGAACGAGTCGGTTAACACAGTCGCTCCTGCATGAATCGACATCAAAACCGACAGCCTCAAGAGAGGCCCCCCCGAGTATAGCCAATGCTCCAACATTGCCTCTTTG
GACGCTTTGCAAACTACCCTCCCGGTCCTCTTTCAAGAGCATTGAGAGGCCTCCACGCAAGTGTTCCTATAGCCAGAGCAAATACAAGCTGAACAGTGCATTCCCAGGCCGCACCTCTCA
ACTTCGCAGTCTCTCGCTGACGACCTCTTTCGACTGAGTCTTCGGCCCCTTGTTGTCAAACAGGTACTTTTATGACCGAAGCAAATACGAGCTGGATGACGCGCTCAAGCTGACGGACTA
CCAGAATCGGAGGGGAGGACGAGTGCAGCTGCTGCCGCTGCAGGCGCCCTTCAGCGAGTTCGACGATCCCGAGAAGGGGGACGCGCTCAACACGTTTGAGCTGGCGCTTGGCTTGGAGAA
GATCCAGAACGAAAAGTACCTTGCACTGCAGGCG
GTGAGACCGCTTTTAAGATTTTCGCAATATGGAGATGAGAGTCTGGACGATCCAGGCCGCTGGAGCTTTCTCTGTTCAGGATCGTA
GCTACATTGCTGCCTTGCAGACGCTGAGGCGGCTTATAAGTTGTGGGTATCACACGTTCTTCTGGGCCGATGTGTCAATTCTGGATGCAATACTGGTATGAGGGCAGAAGCCAGTCCTTT
CAGAGAGGGCATAGTGATACTGACATAGCGAACATGATGCAGTCCGCGCGGCATCTGTGGTTTGTATTCCAATTGTTTGGCTGCTTAGTTGTATCCAATCGGAAGCAGATTGATCTAAAA
GAACCCAACAGCAGACAGTCGTTTCCCTGTGTATAAGATCCACTGAGCAGTTTTCGTTCTGTTTGGGGTTGTACTCGGGACAAGCATCGTGGATTGCAATTGTGTACAGTGGGCTGCGAA
GCAAGATCGATGTGACCCCCTTTCTGGATTTGACTCAAAAGCTGTCCTACTTAGAAAGGTATTTAACTACTAATCTTTTTATAGGGGCAAGCAATGAAGATGGCAGAGAACCTGGGAATT
GAGAACAAAGAAGCACTTTCGGGAGCAATATCGATATGAACCTCAGATTCGCGCATCAGAGTGTCCGAAATCATGCTTGGTTGAGTGGACGAGATTTGAGTCTTGTCTTATCTGGACGAG
GCCTCCTGGCGTGGGGGGCATGGTTCGAGGAGTCGGACGTTCCCCCGGGGCCCTTAAGATCGTTCCCGTTGTTGTTAAACGATCTGCACTGATGCAATGTGCGCCGGATCTCTGGTAGCT
CCTCTGCACTGAGATTTTCAACCTCTGACTCTCGCGTCTCTGCTCGTTTGCTCAGGCGATTGCGGAGGTCGGCGATCCCCAAGCGGACGACTACGTGAAGAGCACATACTTGCATCCCCA
G
GTAAGAGCTAGACATCAGGTGGAGGCCTTCCAAGGAATTGCTGCTTTTCTGTGGTTGAGTAACCATTGAGATGGGGCAAGTTGCTTTGCGCTCATCTGCTGCTACGGGCTCGTCAGAAA
CTCCAGGCACAAACCCAACCCGGATTGACACTCCGAGGCTGGTTATTAGTCTCAAACGGAAGGCTTCCTTGTGGATCTTCGGAGTCGCTCCTAAGCTCAAATGTTTGCTTACAGTTTGCC
TTATCAGCTTGGATCTTTCGTATGTTCCATCCGGCATTGTCGACGAACCGTCCGGGATTGCATGATATAACATTTGAAGCGAGCAATCAGGAAATACGACGTACCAAAGGAATGGTTTGC
AGAAACCCCCTCTTTTGACCTGCTAAGAACCGAATATCTGGGAAAGAACTGAAGCAGCTCATCCAATAACGACGCGTTCAGCAAGAAGCTCGAGACTTGAGTCAAACCGTTGTTAAAGGC
TCTTTTTCAAGCCCGCCTGATCAGAAGCTGCCGTCTGTTTTCTTTACATAACTCACTTATCAAGGCTCTTCGTTCTGCAGATTGAGAAGTTGAAGCGGACTGCCGAGCAGGTGCGACAGC
TCAGGCGGGTTGGAAAGGGTTACGGTGTGTGGCATTTCGACCAAGAATTAGAGGGCGGGGAGGAGATTCCAGAGCCTGTAGCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTTTTCACTGGCGCACGCTGGTGTGCTGAACCTACAAGCTTTGGCATTCTCTCCTGCCTCTTGTACCACCTCTCAGAATGCTGTGAGGTCCTCAACAGGAGTTGCGCCAGCTTTC
ATGAAGCAGCGCGCGCCATTCATGTTTAACTCAAGGAGACGTTGCGCTTCGATCGTGGCAGCAGCAGATGGCAACTCCAGCTATCGGGACTTAGAAACCGTGTCGGCTGGAAGTACAGAA
GAAATTAGCGAAGAGGTGCTTGGGGGCGAGATTTTCAGGCCGATGCAG
GATCTTCAAGAGTCTGGCATCCTTGACCTTGTGGACCAACGAGGCAACGACACATCGCTGGCCAGGCAGCGC
TACTCTCCAGACACGGAGACCGCCATCAATGACTCAATCAATGTTGCATATACGCTCAGCTATGCATTCCACAGCATGGCGGCCTTCTTCGATCGGGACAACATCGCGCTTCAGAACGTC
GCCAA
GTACTTTTATGACCGAAGCAAATACGAGCTGGATGACGCGCTCAAGCTGACGGACTACCAGAATCGGAGGGGAGGACGAGTGCAGCTGCTGCCGCTGCAGGCGCCCTTCAGCGAG
TTCGACGATCCCGAGAAGGGGGACGCGCTCAACACGTTTGAGCTGGCGCTTGGCTTGGAGAAGATCCAGAACGAAAAGTACCTTGCACTGCAGGCG
GCGATTGCGGAGGTCGGCGATCCC
CAAGCGGACGACTACGTGAAGAGCACATACTTGCATCCCCAG
ATTGAGAAGTTGAAGCGGACTGCCGAGCAGGTGCGACAGCTCAGGCGGGTTGGAAAGGGTTACGGTGTGTGGCATTTC
GACCAAGAATTAGAGGGCGGGGAGGAGATTCCAGAGCCTGTAGCTTAG

Retrieve as FASTA