Entry information : KflFer03 (Kfl_000930270)
Entry ID 13897
Creation 2016-10-14 (Christophe Dunand)
Last sequence changes 2016-10-14 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-10-14 (Christophe Dunand)
Peroxidase information: KflFer03 (Kfl_000930270)
Name (synonym) KflFer03 (Kfl_000930270)
Class Ferritin    [Orthogroup: Fer004]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflFer03
start..stop
S start..stop
KflFer04 277 8e-94 10..217 104..311
SpolFer01 170 8e-53 11..204 60..250
CbraFer03 168 2e-52 10..209 15..213
LeFer01 167 9e-52 11..204 60..250
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 143307..143336 30 N° 2 142706..142836 131 N° 3 141974..142118 145 N° 4 141157..141244 88
N° 5 140777..140838 62 N° 6 140204..140269 66 N° 7 139181..139245 65 N° 8 138527..138668 142
complement(join(138527..138668,139181..139245,140204..140269,140777..140838,1411 57..141244,141974..142118,142706..142836,143307..143336))


exon

Literature and cross-references KflFer03 (Kfl_000930270)
DNA ref. GenBank:   DF237042.1 (143336..138527)
Protein sequence: KflFer03 (Kfl_000930270)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   242
PWM (Da):   %s   27059.51  
PI (pH):   %s   5.01
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKEGASGDKVYDVIAEIKALGLEKLVPEEGRLGAFARQRWSDKREAGLNDIINHSYAMSYALHSLASFCARDYVSLKGLARFYADRSDRERTCAMELSRYGLRGGKVVLYQIGQPESEFDHEEKGEALYTMEIVLAIFKVHNEKLRDLNLAAEENDDEFSDYLTDGFIHPLVITVKKLAGMVTQLRRVGKGHGTWHFDHSLNKRLKKHEVGEEIADSGGETSEEEEDESEAALHADVAV

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAAGGAAGGGGCATCCGGAGACAAGGTGAGACGCTTCACTGAGAATGCAAACGCTCTCTAACATTCCGCAGCTATTCTTTCCTCCGGAAGTGGGTCCAGAATGGAAGGTTCCTGA
TGCGCTATGTTTCGTCATGAGTTTTTGGCTTTCCCGTGAAGAACGTGATGGCTGGCAGCGCCTTTAAAAGTGAGTTGCGCTTCGTCAAATTTTGGAGACGCCCCCATGCCTCCAACGAAA
ATTGAAAAGTCGCTCATCATGCAAGCAACCTTGGAAGTCAGCCACGGACCCACCAACCGAAACGAGAGCACAGGAAGTCCTCCAACAACCTTGATGCAAACCAGAGGATATTCGCCCAGC
AACCTCTTCCCTCAAAGCGCTTCCAGACGGCAGAAGAAAATGGCGTATCCCGCGCATGACTCATAAGCGATGCCTGAATTGAGGGCCGCTTGAATCCATCATCTTCAGACACCCCATTGC
GCGCGCGCATTCCGTCCCAGGTGTATGACGTCATCGCTGAGATCAAGGCCCTGGGCCTGGAGAAGCTGGTGCCCGAGGAGGGCCGCCTCGGCGCGTTTGCGCGCCAGCGCTGGTCGGACA
AGCGGGAGGCGGGCCTCAATGACATCATCAA
GTGAGGGCTCCACAAGAGTCTCGTTCCTTTCATCCCGTGGGCCTTCAGTTCTTCTCAGCGCTGCCGGAAGTTGAAACTGCGGTCCTCAA
GAAAGGCACCAGACACGTTCTGCTTGGCGCATCCATCAACCTGATGAATGTCGCAACCCCTAGATCAGAGGGGGGCTTGGTTGTATTATCAACCTGTGTTTAAGATGATATTGTTCTTTA
TTCACACAGGAGAAACCTCAGAGAAGTACTGGGGAACCCCCCAGGACTAATTACGGGCAAAGCCAAAACTCTCCGTTGCGTTGCTGTTCTGGTGGACCAGTCGACATACACATATTAGTT
GAAACCTGGTTTTTGGTTTGCTCCACCTAGTTCCCTTCAGAGTTAGTCGCGGCCCGAGAGTGCCTCGCTCATTCTGCCCCCACCTTTCTGTCTCACTAGCTTGAGATCTGCAGTCTCGAC
ATTCACGTGCTGGCGCCCAATCTGACTTTCGCCTCAAACCAACAAACTCTGCTCCGATCTCCAAGTTTCCTCTTTCCTTCCAATCCAAATGTTTCCGAGCTTCCCTTCGTATGTCTACCC
CTTTTTGCATGTCTCCAGCCACTCATACGCTATGTCGTACGCGCTCCATTCGCTCGCGAGCTTCTGCGCGCGCGACTACGTGTCCCTGAAGGGCCTCGCGCGCTTCTACGCCGACAGGAG
CGACCGAGAGCGCACCTGCGCGATGGAGCTGTCGCGCTACCAG
GTACGAGACCATTTCTTTCGTTCTTTTCCATCGCCGCCTAAGCAAATAGCTTTGCAAACTTACTCAATTGCCTGATA
AACGGCACGGATGACCTAAATGGAATGATCACGAGGGATCCCAGATACAGACATAGTTCCGGGCGGTGTGCGAAAGGATTGATAGAAGAGACGGCTGGTTTTCCATAAAGTTGAACCATC
GAAAAGCACAGACAAATTGAACAAGCACGGCACAAGTCATTCTCACGATGTTCTTTCCGAGTTTCGAGGAACGGTGGACTTTCTGATTGCCCTGTTAGGAAGTCAACCGCGGCTCAGTCC
TTTATTCTCTTCACTTTTTAGCTTCTCTTCGGAAGAAAGTCAGGACGTGGGCTGTATTGAGTTGGGCAGTAGAGATTACCGGCCCAGCGTTCTGTAATTTTGCACTGCCTCGGATCACCG
AAAGCCCCCCACTCCTCAGATGGCTGAGCGCTTTTCAACCGCCCATTCAAGTCCAATTCGGCCCATCCAAGACTTTGGGCCGTGTCAATATTCTCGCGTTTTGGATCCCTTTCCGACTTC
CTGAATGCAATTAGGTGATTCCTGTCCAGTCAACCACTTGCGTCCTCACACTTTGTCGGAAATTGAGCAATTCACAATGTGGTACTCCGTTAGAAACGAGCTCCGTTCAAATTTTTACTT
GCAACCTTCGTAAGTTTATCATCTCAGAAACGTGAATGAGCACGACGTGCAGGGCCTGCGTGGCGGGAAGGTGGTGCTGTACCAGATCGGGCAGCCGGAGTCTGAGTTCGACCACGAAGA
AAAGGGCGAGGCGCTCTACA
GTAAGTTCCGGGCTCGAAAGCGGAATCCGCTGCGCTTCGTGGCTTTTCTTGTGAGCGTTGGCAAGTGAGCGACTGCTCTAGACACACCAGTATTGTCTAC
TTCTGGAATTGTACGCAGATTCATGCTTACGCAAGCGGCCGATCAAAACCCGTGAACCTGCCTTTAAATCCTTGGTAGCTTATCTTCGGCTCCGTTCCCGAAAGAGCCCTTTCCTGTCAG
AGTGTTTACAAATGTGTTCAACACGGCACTTCCGTTCGCTCTGGTCTTCAATTTGGTCGGCGGAATCCTAACGAAATCTCTATTTTTCCCCTGTGCAGCCATGGAGATCGTTCTGGCAAT
CTTCAAGGTCCACAACGAGAAGCTCCGCGACCTTAACCAG
GCACGTACCAGCTTCTAGTGCGCTGCGTTACTGTTGGTAGGATACGGATGACGCGCTCAGATGTAACAAAATCGTTTCCG
TGTAAAGCGCAACTTATCCCCCTTGGTTGCAGCGCGCGGTTGCCTTGCCGAGTCGCAGAGATCTCCTTCCATAACAGCAGCCTCGCCGATTCGTAGGGATGATTTACCGAAGAGAACCCC
CTCAGTCAGAGGACCCAAGAACTACAGTAGTGCAGCGACGTCGCTCTCTCACAACTTTATCTGCAAAGTGGTACTGCGCGTAGAGCGTCCGTCAGTAGATTGGGTAAAGCTTTCTGCTTA
GTGCTCACTTCGAGCTTTCTTTTCGAGCTTTGATTGTATCACTTTCGATCCGCCGCTCATGTGCTTGCTACAAGTGGTTCACGCGAGTAGGAATTCCTAGAATAACCCAGGGGGATAGTT
CGACTTATTGGAGAGCCGCAACAAAGCTTCTCGTTCCAGAGCTGATGGGAGTCTTAATGCCTCGCAGCTGGCAGCCGAAGAGAACGACGACGAGTTCTCCGATTACCTCACCGACGGCTT
CATCCATCCCCTG
GTGAGGCATTAAACTCCCTTCTCAATCATCTTTGATCTTTTTCAAAGTTTCTCCGCATATAATGATTTTTGTTCATCTTCGCCCAGCTCTGAATGTTCTTTCGCGTC
TTCGCTGTTGCAACAGGGTATGTTTCAAATCGGTCTATCTTGGTGAAAAGATGCGTCACACGATCCACCACTGCTCTCAGTGAGATCCATGTTCCAAAATTTGTTTTGGACAAGCTTGTA
CGGCGGTTTGTTTGGGTGTAAGTGCCCGTTGCTGCTTCTCACTTCGTGAACCCCGATTGTTTTGGTTCACTTTTGAAAGGTGGCCATGATGCAACGATATTTTCTGGGAAGAAAGTGTCC
TCTCAGAGGACTTGTCAGGTTGCCCTTCGGAGCCACAGTCAAAGTTTCTTGAAATACCCCGACGCGAAGATCCCTTCATCTTTTATTTCAAATTGCGGCTCAACCCAGAAGTACGCAACT
AAGATTGGAGGAACATTTCCAGCTCCCCTGCTCTCAACTTTCCGCGGTGGATACACGTCTGCACTCCCCCATTAGAGTACCGTTGCTCCGTATTCTTGTTAGCTGTTTTGTGAGGAAAAT
GTTTGTTTTCGGTATAACATGTATAAAGAATAGGTTGCTCAACCATACGTATCCGTGCTGGGCCTGAACTCCTAAACTTTGCTCCAGTCTGCGCTCTTCCTCATTTCGATGCAACCACTT
CTCTTGGCAGCACGTATTCACGATCTAGCAAGGGACTGACCTGCCGAGCGGTGAAGCATTTGTGCTCTTTCTGTTCCCTTTCTCCATTTCCTTGCACCCGTCGCTGAGGCTTTCATTTCA
AGTACAAGCACTTTCGGACTGTTTCGGAAACCGCCCACGTGAGCGCTCGGCCGGCTGCCGGTGTTGCCGCGGGTTTTACACGTCACACTACCCGCGCGCGCTTTGAACAACTTTCCTGCG
CGCGCTCGCAGGTGATCACCGTCAAGAAGCTGGCCGGCATGGTGACCCAGCTGCGCCGCGTCGGCAAGGGCCACGGGTAAACTCCTTTAAGCCCAAACCCCTTTGCACCTCTGAATTTTC
AGCAACGTATGTTTGGTCTAATTCTTCTAAAACGTAGAGCTCAAGCCTTCGACCATTGAAAGGAGTACGCAAGTAACGTGTTGGGACGGCTCAGAGGTCAACATTTCTTTGACTGATGTT
TTATGGGAGCAGCCCGTGAGTCCGTCGCATGAAACAAGTGCTGTCCCGCAAATTTGTTACTTGGAGAGAAACCATTCTGCGTCCCTTGTATGCAACACTCAACACCTCGACACCACTGTA
CAACAAAGCTGGCGCTGCGTTCGCTTCTTTTGCGAGCTACTGCCAGTGTCCAAATCCGAAGCGTTTATATCCCCTCGCCCTTCCTGCTTGCAAGTACACGTGGCAGATTGGCGACGCCCA
GAACCAGGAGCGAAAAAAGAAGCTGTCGTCGCTCAGCCCTATTGACGGAGCTATTGACGGGGTAAAATCACAGCCGTTGATCACCCTATGTCGCTCTCCGATGTGCAGCACGTGGCACTT
CGACCACTCTCTGAACAAGAGGCTGAAGAAGCACGAGGTGGGGGAGGAGATTGCGGACAGCGGCGGCGAGACGTCGGAGGAAGAGGAGGACGAGTCTGAGGCCGCGCTTCATGCGGACGT
GGCAGTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAAGGAAGGGGCATCCGGAGACAAGGTGTATGACGTCATCGCTGAGATCAAGGCCCTGGGCCTGGAGAAGCTGGTGCCCGAGGAGGGCCGCCTCGGCGCGTTTGCGCGCCAGCGC
TGGTCGGACAAGCGGGAGGCGGGCCTCAATGACATCATCAA
CCACTCATACGCTATGTCGTACGCGCTCCATTCGCTCGCGAGCTTCTGCGCGCGCGACTACGTGTCCCTGAAGGGCCTC
GCGCGCTTCTACGCCGACAGGAGCGACCGAGAGCGCACCTGCGCGATGGAGCTGTCGCGCTACCAG
GGCCTGCGTGGCGGGAAGGTGGTGCTGTACCAGATCGGGCAGCCGGAGTCTGAG
TTCGACCACGAAGAAAAGGGCGAGGCGCTCTACA
CCATGGAGATCGTTCTGGCAATCTTCAAGGTCCACAACGAGAAGCTCCGCGACCTTAACCAGCTGGCAGCCGAAGAGAACGACGAC
GAGTTCTCCGATTACCTCACCGACGGCTTCATCCATCCCCTG
GTGATCACCGTCAAGAAGCTGGCCGGCATGGTGACCCAGCTGCGCCGCGTCGGCAAGGGCCACGGCACGTGGCACTTC
GACCACTCTCTGAACAAGAGGCTGAAGAAGCACGAGGTGGGGGAGGAGATTGCGGACAGCGGCGGCGAGACGTCGGAGGAAGAGGAGGACGAGTCTGAGGCCGCGCTTCATGCGGACGTG
GCAGTCTGA

Retrieve as FASTA