Entry information : KflFer04 (Kfl_000930280)
Entry ID 13898
Creation 2016-10-14 (Christophe Dunand)
Last sequence changes 2016-10-14 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-10-14 (Christophe Dunand)
Peroxidase information: KflFer04 (Kfl_000930280)
Name (synonym) KflFer04 (Kfl_000930280)
Class Ferritin    [Orthogroup: Fer004]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflFer04
start..stop
S start..stop
KflFer03 276 1e-93 104..311 10..217
CbraFer03 182 4e-57 96..303 7..213
CbraFer01 175 1e-53 80..304 30..250
KflFer01 167 3e-50 103..303 75..272
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 144415..144726 312 N° 2 145588..145718 131 N° 3 146065..146209 145 N° 4 146681..146768 88
N° 5 147174..147235 62 N° 6 147618..147683 66 N° 7 147968..148032 65 N° 8 148442..148541 100
join(144415..144726,145588..145718,146065..146209,146681..146768,147174..147235, 147618..147683,147968..148032,148442..148541)


exon

Literature and cross-references KflFer04 (Kfl_000930280)
DNA ref. GenBank:   DF237042.1 (144415..148541)
Protein sequence: KflFer04 (Kfl_000930280)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322
PWM (Da):   %s   35884.3  
PI (pH):   %s   6.52
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAPASLMRIVFPLLSRNSSNFLRSGVLLNGPPSFWQLESVSKFSTLVRSSNLSGLPKANKLWTNEAAELIPERLVTSCALAAISGRPKIELVLERGAHNEAGKVYDVLSEVNSVGLENLVPADGTKESIVRQEWPSKLESGLNDMINVSYSISYALHALSSYCSRDYVSLRGLARWYIDRSNRERADALELSRYSLRGGKTMLCPIGESQTDFDHDQKGDALYTMELVLAMYKLQEQKFRDLALADEEGDQEFSDFITDSFLSHLTVLVKKTAGYVAQLRRVGKGHGTWHFDHYLHKKLEGDHVGDELRTGLHELEGTK

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCGCCAGCTTCGTTAATGAGGATCGTCTTTCCGCTTCTGAGCCGGAATTCTTCGAACTTTCTGAGAAGCGGAGTCCTTCTCAACGGCCCGCCAAGCTTTTGGCAGCTCGAATCG
GTCTCAAAGTTCTCTACTCTGGTTAGAAGCAGCAATCTGAGCGGCCTTCCAAAGGCCAACAAGCTATGGACGAACGAGGCAGCTGAGCTCATCCCTGAGAGGCTTGTGACGTCATGTGCC
CTTGCTGCAATCAGCGGAAGGCCAAAGATCGAGCTGGTACTGGAGAGGGGCGCCCATAACGAGGCTGGGAAG
GTGAGACTTCGTGCTTCCCAAGACCCTGAAGGTGAATCTAGAAGATGG
CGATCTGGTTAAGTTTCCAGTCAGATAGGGCAACATGCTTCATGAGTTGCTGGATTGCCTGTCCTGAAGGCAATGCTGTTAGGATGCTCTAATTCTTTGTAAGGGAAGCTCCTTTGATTG
CGAATTGCACTCAGAACACCCGTGGAGCACAACAAATAGAGATGCTTTGTGTAACCAGAGCTTTTGAAGAAAGTTTTTCTCGTGCTACTAGGTTGCAGCTCCTGGGTTCAGATCATAGCA
ATAGCTTTTGTAGAGCAACTAGTGTCATTTTGAACAAATGTTTCTGGGTTAGCGAAACCTGAGACTGACTTGCTTTCAAAATCGAAGGATGGCGAACAAGTTGTAATACGACCAACTTCG
ACCAAGCCGGAGAAAATTGCAGATTTTATCAGAATGCAGACAGTTGCGGAGAACGGTTTACAGGTTACCATCTGGAGAAAACTCGCTCAGATAGCACCAGAGCTCTAAGTCAGAAAGTGG
GACCAGAATGCAGTATTTAACCACGTATGGGGGAAAAAATCTGAAGCTGACAAGGTTTCGAGGGAAGTGGTCCTTCAAAGGAATCCTTGCTTTCGGCTATTGCAAGATCCGCTTGCAATT
GGTCAAAATCCTCCGGCTAGCATCCCTCTTCCACCCTTTCACTGTCTTTGAAGTAGTGACCTGTTTCCACGAAAGAGATCAACCGTTGTTGTTGGATACATTTTTAAGGTCGGAAGGGTA
ATCCTCCTACTTTGGATTGGATTATAAGCAAACGCCCAACATATCTTCTCAATACGGATCGTGATCTTCGTACTTGTACCCGTTGCTCTTCAGGTGTACGACGTCCTGTCCGAAGTAAAT
TCCGTCGGGCTCGAAAATCTGGTTCCCGCTGATGGTACGAAGGAGAGCATCGTCCGCCAGGAGTGGCCGAGCAAGCTGGAGAGCGGTCTCAACGACATGATCAA
GTAAGCCAGCAGTTAG
CGTGCAGCTAAAAAAGTTGCACAGTCAGTCGAGTAAAACTGCTATTGTGTTGGCCTGTGCCTTGCAAAGGTTCCCGTCTTCTTTACACTTCGTTTGCGTTTTCGGGCATCACTCTGCGAA
TGACAGACAAGTCTTTGAGCAGCACATTCCGACCTCACTCCGTTTCCATCGTTAAAAAGTAACGCGTTCACCGCAAAGTCACGCGTACAGAAATCCTCAAGCTCCTGAAAAAGGGAGGAT
GCGAGCAGAGATAATGCACGAAGAGCAGAAGAGCCAGGACTTTCTTCGAACTGATTCGACGACATTTTCCGCCCCCGTTTTTTCCCGCAGCGTGTCCTACAGCATCTCGTATGCTCTGCA
CGCCCTCTCGAGCTACTGCTCGCGCGACTACGTCAGCCTGCGCGGCCTCGCGCGCTGGTACATCGACCGCAGCAACCGGGAGCGCGCGGACGCGCTCGAGCTGTCGCGCTATCAG
GTGCG
AAATGCGCGGATTCTAGGTCGTAATGTTCCAATCCACAATACTGTCGAATTAGAAGCGAAGAATGACGCAGAGGGGTTTTGAAGACACCTGTGTCCGTCAAGGAAGACGTCTTCGAATCT
GCCCGAGTAGTGTTCGTAATTTGCAGCTTTTTCCGGGTTTCAAGCGGCACCTCACATCGGCTCTTAAAAACAGAAGATTTGCTTTGTCTGCTCGATTGATTGCCCGTCGATCCTCTTGCA
GTTGCACTTTCGGTCGAAGTTCGAAACGTCGCTCTTGGTCTGCTAAGTTCCAGGTTTATTTTCTCGTGAGCTGGGAGAGCCTACGGTCGCCAAAAGAGCGCGTTTGAGGCGCCCGGGGAT
TTTTTTTGAAAAATGTTTGTGTTTGCATTCTTTGTGACGGCCATGTATCGGGACGCTTCATCTCTAAAACTCGGTCCGCCATAGACAAGAAGGACGTCGTCTGCAGAGTCTCCGTGGCGG
GAAGACGATGCTCTGCCCCATCGGCGAGTCCCAGACCGACTTCGACCATGATCAAAAGGGCGACGCCCTCTACA
GTAAGACTTTCTGACCTTGCGTGAAAAGAAGCCTGACCTCGTTCGC
TCACGCCCCTGTCCGAAGCAAAAAAAACCTGCTTTAGCACACGTTGATGCATCGGTGGAGATCTTGTCAGAACAGATCTGCGACAAAATGGGTTTATGGCTACTTGATTAGTTTTGAATT
TTCCTCAAGACTTCGTGGCATAAGAAGAAAACTGAGGGGTCTGTCTTCAATGGCAGCCGTGGTGCAGCGACGCTGTTCCGCCAGACGTCGTATCCAACTTCGGACGAGGCTGGTCGGAGT
CTAGCCGGCCGACAGGTTGGCTTGCGGACCTCACTTGCACCAGTTTCAGGCGGCACCAAAGTCTGGGACGTTTTGAGAACCAACAGTCACTGAGATGTCACGTCGTCCTTTGCGTGCAGC
GATGGAGCTGGTTCTTGCCATGTACAAACTCCAGGAACAGAAATTCCGAGACCTGGCGCGG
GTAAGTCTCACAACCAACGACTATATTGTGTGGTATGGACATGGCACAAAGTGAGCTGA
AAGCAGTCTTCCTGTGGTCGTATTTGACATCAGAACATTGCCCTTGAAGCTAGGGAGTAAAGGGCTGCAAGGTGCACAGGTTGCGAGTTGATTCCAGGTACCGGACCGCCCCCGACCTCA
CCGTTTTCATGTTAGTCCGCGACCTCAGATTTCGGTGCGATATTGGGAAAGAGCTCAGATTTTGGTGCAATATTGGGAAAGAGCTTTGAAAGCTGGTGCAAGGGGGTAATTTATAAACCG
TTCTTCAGACACAGCCGAAAATTTGAAGAAGGTCATCTGGTGTGAATCAGCTTCAATGAGGAGAAGGGTGTTTCGATGTGCAGCTAGCAGACGAGGAAGGGGATCAGGAGTTCTCGGACT
TCATCACCGACAGTTTTCTCAGCCACCTG
GTACGTTCCACCTCTCCTCACGAATCTCTTTCTCTCCCGTGCAATCTTCGCTTATGCGATTCGAGGACGAGGTTCGAAGTTACTAGTATCG
TTGCGTGGCTGAGGGCTCTCCGTGAGATCCTTGAGGGCTCCCCTTTTCTGCCTTTGTCTCGTGTGCGGTACACTTCCCCTCCGACTCTGACGATTTAGGATGTCGAAGTGCTCTCGTAGT
CAAAGCCGTGGCAAGTTGTCGATGAGACGAAGCGCTATTCCCTTCTCAGCGTGCGCCACGTGTCGATGTGCAGACCGTCCTCGTGAAGAAGACCGCCGGCTACGTGGCGCAGCTGCGCCG
CGTCGGCAAGGGGCACGG
GTAAGAGCGTTACTAAAAACCCGCTCATGGAGTCTCGTAGGCTTTGACTGGAACGCGGCCTCGCTCCTAGCTGCGCAGTAACATTACTTGAACCGAGAAGCC
ACGACATAGGTCATTGCGGATGCTCTCTTTTTAAGAGATGGATGGCCTTTTCAATGGGCCTTCCCCACCTCTACTTTCTGGCTCCGCCAAGTTGACCATAAGGCCCTTGAAGACCAGGGC
TTCTGGTAAGAGGTCGAAGATTAGGAGAAATTAGCCTTTGTCGTGAACCTTATTCCGTCCTTGTTCGTGGCCGACGTAGAGGCCGCAAGAAAAGGAAGCGGGGATGCCCCCCCGCTCAAG
AACAGAACAGGGCGGTTACGTCTACCAGGCAGTGACCGGGCTAACTAACGCACCCCGCTTGCCGCAGCACGTGGCACTTCGACCACTACCTGCACAAGAAGCTGGAAGGGGACCACGTGG
GGGACGAGTTACGTACCGGGCTGCACGAACTTGAAGGGACGAAGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCGCCAGCTTCGTTAATGAGGATCGTCTTTCCGCTTCTGAGCCGGAATTCTTCGAACTTTCTGAGAAGCGGAGTCCTTCTCAACGGCCCGCCAAGCTTTTGGCAGCTCGAATCG
GTCTCAAAGTTCTCTACTCTGGTTAGAAGCAGCAATCTGAGCGGCCTTCCAAAGGCCAACAAGCTATGGACGAACGAGGCAGCTGAGCTCATCCCTGAGAGGCTTGTGACGTCATGTGCC
CTTGCTGCAATCAGCGGAAGGCCAAAGATCGAGCTGGTACTGGAGAGGGGCGCCCATAACGAGGCTGGGAAG
GTGTACGACGTCCTGTCCGAAGTAAATTCCGTCGGGCTCGAAAATCTG
GTTCCCGCTGATGGTACGAAGGAGAGCATCGTCCGCCAGGAGTGGCCGAGCAAGCTGGAGAGCGGTCTCAACGACATGATCAA
CGTGTCCTACAGCATCTCGTATGCTCTGCACGCCCTC
TCGAGCTACTGCTCGCGCGACTACGTCAGCCTGCGCGGCCTCGCGCGCTGGTACATCGACCGCAGCAACCGGGAGCGCGCGGACGCGCTCGAGCTGTCGCGCTATCAG
AGTCTCCGTGGC
GGGAAGACGATGCTCTGCCCCATCGGCGAGTCCCAGACCGACTTCGACCATGATCAAAAGGGCGACGCCCTCTACA
CGATGGAGCTGGTTCTTGCCATGTACAAACTCCAGGAACAGAAA
TTCCGAGACCTGGCGCGG
CTAGCAGACGAGGAAGGGGATCAGGAGTTCTCGGACTTCATCACCGACAGTTTTCTCAGCCACCTGACCGTCCTCGTGAAGAAGACCGCCGGCTACGTGGCG
CAGCTGCGCCGCGTCGGCAAGGGGCACGG
CACGTGGCACTTCGACCACTACCTGCACAAGAAGCTGGAAGGGGACCACGTGGGGGACGAGTTACGTACCGGGCTGCACGAACTTGAAGGG
ACGAAGTAG

Retrieve as FASTA